DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and senju

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_608902.1 Gene:senju / 33734 FlyBaseID:FBgn0031676 Length:388 Species:Drosophila melanogaster


Alignment Length:323 Identity:82/323 - (25%)
Similarity:150/323 - (46%) Gaps:54/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 TAVLMAEFAKLI--TCLFLVFNEEGKDAQKFVRSLHK--TIIANPMDTLKVCVPSLVYIVQNNLL 116
            |.||:.|..|||  |||:...|    :.:..||.:.|  .::...|      ||:.:|.:.|||.
  Fly    48 TVVLLTEVFKLIVSTCLYCRDN----NLRSLVRDVQKDRNVLGLYM------VPAFLYCLYNNLA 102

  Fly   117 YVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGS 181
            :|:.:..|..||.:..||:::.|.:...:|.::.|...||.:|:||.:|.::.|:         .
  Fly   103 FVNLATFDPTTYYLLLQLRVVVTGILFQIIFKKYLSQRQWISLILLTLGCMMKQV---------D 158

  Fly   182 AGGAAAAATAASSGGAPEQ-----------------NRMLGLWAALGACFL------SGFAGIYF 223
            .|...:.|...|...|.:|                 ..|.|...:|.|.|:      |..||:|.
  Fly   159 FGSFYSDANDDSESAAIQQQLQSHNKTTSAETHAHGKNMSGFDFSLSAVFILAQTICSCLAGVYN 223

  Fly   224 EKIL--KGAEISVWMRNVQLSLLSIPFG----LLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQA 282
            |.:|  |||:::::::||.:.|.||...    ||...:.|.....:.|....:.:.:  :::..|
  Fly   224 EYLLKDKGADVNIFVQNVFMYLDSIVCNAVILLLRGELLDAFSPQNLGSIMRFSVLI--IIVNNA 286

  Fly   283 GGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDP 345
            ..|::.:..:||.::|||.||::|.::.:.|...::|...:.:..:....:|..:|:||...|
  Fly   287 AIGIVTSFFLKYMNSILKTFASALELLFTAVLCYFLFSIPIYMNTALAIAVVSYAIYLYTQSP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 80/318 (25%)
EamA 101..341 CDD:304911 64/268 (24%)
senjuNP_608902.1 Nuc_sug_transp 44..346 CDD:282054 80/318 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466583
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.