DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35a1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_006238058.1 Gene:Slc35a1 / 313139 RGDID:1311359 Length:336 Species:Rattus norvegicus


Alignment Length:320 Identity:133/320 - (41%)
Similarity:195/320 - (60%) Gaps:18/320 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRS 87
            |...|..:||..|...:::||.||....::.|:|||.:.|..||:..:.|:..|.| ...:|..|
  Rat    13 KLYCLTVMTLVAAAYTIALRYTRTTAEGLYFSTTAVCITEVIKLLISVGLLAKETG-SLGRFKAS 76

  Fly    88 LHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLL 152
            |.:.::.:|.:.||:.||||||.||||:.:::.|:||||.|||||||||..||:..|::|.|.|.
  Rat    77 LSENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLS 141

  Fly   153 NTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSG 217
            ..||.::.:|..|:.|||....:          |.....|       ||.:||..|...|...||
  Rat   142 KLQWISVFMLCGGVTLVQWKPAQ----------ATKVVVA-------QNPLLGFGAIAIAVLCSG 189

  Fly   218 FAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQA 282
            |||:||||:||.::.|:|:||:|:.|..|...|...:::||:.|.::|||.||..:||:::.|.:
  Rat   190 FAGVYFEKVLKSSDTSLWVRNIQMYLSGIAVTLAGTYLSDGAEIKEKGFFYGYTYYVWFVIFLAS 254

  Fly   283 GGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYG 342
            .|||..:|||||.|||:|||:.:.||::|.|||:.:|...:||.|:.||.||..||:|||
  Rat   255 VGGLYTSVVVKYTDNIMKGFSAAAAIVLSTVASVILFGLQITLSFTLGALLVCVSIYLYG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 131/318 (41%)
EamA 101..341 CDD:304911 106/239 (44%)
Slc35a1XP_006238058.1 Nuc_sug_transp 8..314 CDD:282054 131/318 (41%)
nst 90..313 CDD:129885 106/239 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D540031at33208
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10231
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.