DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35a3

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001012082.1 Gene:Slc35a3 / 310808 RGDID:1308615 Length:326 Species:Rattus norvegicus


Alignment Length:340 Identity:168/340 - (49%)
Similarity:226/340 - (66%) Gaps:19/340 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VNANTLKYISLLTLTLQNAILGLSMRYART--RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGK 79
            ::|| |||:||..|..|...|.|:|||:||  ..|..:||||||::|||.|::.|:|||:.:...
  Rat     1 MSAN-LKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAEFLKIMACIFLVYKDSKC 64

  Fly    80 DAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAV 144
            ..:...|.||..|:..||:|||:.:||.:|.:|||||||:.|:||||||||||||||||||:|:|
  Rat    65 SVRTLNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSV 129

  Fly   145 VILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAA 209
            .:|.:||...||.:|::|:.|:..||     .|:......:...:|.         ::.:||.|.
  Rat   130 SMLGKKLGMYQWLSLVILMAGVAFVQ-----WPSDSQELNSKDLSTG---------SQFVGLMAV 180

  Fly   210 LGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFV 274
            |.|||.|||||:|||||||..:.|||:||:||......|||:..:|.||..:...|||:||:...
  Rat   181 LIACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNQLT 245

  Fly   275 WYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVAS-IYIFDFNLTLQFSFGAGLVIASI 338
            |.:|:|||.|||::|.|:||||||||||||||:||:|.:.| .::.||..|..|..||.||||:.
  Rat   246 WIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTIISYFWLQDFVPTSVFFLGAILVIAAT 310

  Fly   339 FLYGYDPARSAPKPT 353
            ||||||| :.|..||
  Rat   311 FLYGYDP-KPAGNPT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 160/326 (49%)
EamA 101..341 CDD:304911 120/240 (50%)
Slc35a3NP_001012082.1 Nuc_sug_transp 1..314 CDD:398009 160/327 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D540031at33208
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100998
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1127
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.