DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35b3

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_225253.5 Gene:Slc35b3 / 306866 RGDID:1307183 Length:411 Species:Rattus norvegicus


Alignment Length:385 Identity:77/385 - (20%)
Similarity:122/385 - (31%) Gaps:115/385 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NTLKYISLL----TLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLF--------- 71
            |:.||:|:.    |.|:...|..:.         |:.:  ..|.::.|.||...|.         
  Rat    49 NSRKYVSITVPSKTQTMSPHIKSVE---------DVVV--LGVNLSRFKKLTQFLICVAGVFVFY 102

  Fly    72 --------LVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATY 128
                    |:|:.||.....:..:|           ::....|:..:::..|.......:...||
  Rat   103 LIYGYLQELIFSMEGFKPYGWYLTL-----------VQFAFYSVFGLIELQLTQDKRRRIPGKTY 156

  Fly   129 QVTYQLKILTTAMFAVVILRRKLLNTQWG-------------ALLLLVMGIVLVQLAQTEGPTSG 180
            .:...|.:.|..          |.||..|             .|:.:::|.|.:|     |....
  Rat   157 MIIAFLTVGTMG----------LSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQ-----GKRYN 206

  Fly   181 SAGGAAAAA--------TAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMR 237
            .|..:||..        |.|.|..||..|....:..:|..| .....|...||.:|....|    
  Rat   207 LADVSAAVCMSLGLIWFTLADSTIAPNFNLTGVMLISLALC-ADAVIGNVQEKAMKLHNAS---- 266

  Fly   238 NVQLSLLSIPFGL------LTCFVNDGS----------RIFDQGF---FKGYDLFVWYLVLLQAG 283
            |.::.|.|...|.      |:|....|.          |.:...|   ..||....:.|.|::..
  Rat   267 NSEMVLYSYSIGFVYILLGLSCTSGLGPALAFCSKNPVRTYGYAFLFSLTGYFGISFVLALIKIF 331

  Fly   284 GGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGY 343
            |.|:...|            |:....::.|.|...|....|.|:.:...||:..|||..|
  Rat   332 GALLAVTV------------TTGRKAMTIVLSFLFFAKPFTFQYIWSGLLVVLGIFLNVY 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 76/382 (20%)
EamA 101..341 CDD:304911 57/279 (20%)
Slc35b3XP_225253.5 UAA 90..381 CDD:285625 65/333 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.