DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35f2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001382663.1 Gene:Slc35f2 / 300713 RGDID:1311242 Length:375 Species:Rattus norvegicus


Alignment Length:318 Identity:60/318 - (18%)
Similarity:108/318 - (33%) Gaps:107/318 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 IANPM--DTLKVCVPSLVYIV-------QNNLLY----------------VSASHLDAATYQVTY 132
            :..||  ..:..|:..|||.|       .:|||.                |.|::|....||.|.
  Rat    69 VNTPMLQSFINYCLLFLVYTVMLAFQSGSDNLLEILRRKWWKYTLLGLADVEANYLIVRAYQYTT 133

  Fly   133 QLKILTTAMFAV--------VILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAA 189
            ...:.....|.:        .|||.:.....:.|:.:.::|:             |:..||...|
  Rat   134 LTSVQLLDCFGIPVLMALSWFILRARYKVIHFIAVFVCLLGV-------------GTMVGADILA 185

  Fly   190 TAASSGGAPEQNRMLG---------LWAALGAC------------FLSGFAGIYFEKILKGAEIS 233
            ....:.|:   :.::|         |:|....|            || |..|: |..|:.|    
  Rat   186 GREDNSGS---DVLIGDILVLLGASLYAVSNVCEEYIVKKLSRQEFL-GMVGL-FGTIISG---- 241

  Fly   234 VWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNI 298
                   :.||.:.:       .|.:||       .:|   |.:.||.....|.:..:..:...:
  Rat   242 -------IQLLIVEY-------KDIARI-------QWD---WKIALLFVAFALCMFCLYSFMPLV 282

  Fly   299 LK-GFATSL------AIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSA 349
            :| ..|||:      |.:.|....:::|::..:..:.....:::....||...|.|:|
  Rat   283 MKVTSATSVNLGILTADLYSLFFGLFLFEYKFSGLYILSFTVIMVGFILYCSTPTRTA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 56/309 (18%)
EamA 101..341 CDD:304911 53/298 (18%)
Slc35f2NP_001382663.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.