DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35f6

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_038967844.1 Gene:Slc35f6 / 298851 RGDID:1309228 Length:407 Species:Rattus norvegicus


Alignment Length:356 Identity:69/356 - (19%)
Similarity:141/356 - (39%) Gaps:59/356 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKV 102
            |.|..::...|   |:.:..:.:.||: .:...:|:.....:.:...|..      ..|.:.|..
  Rat    72 GGSQEHSFKHP---FVQAVGMFLGEFS-CLAAFYLLKCRARRQSDSSVEP------RQPFNALLF 126

  Fly   103 CVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIV 167
            ..|:|..:...:::||:.:...|:::|:.....|:.|.:|:|..|.|:|:.:||..:|:.:.|:|
  Rat   127 LPPALCDMTGTSIMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLDRRLVPSQWLGILITIAGLV 191

  Fly   168 LVQLA------QTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKI 226
            :|.||      .::...|....|......|         ..::.:...|...|      :|...|
  Rat   192 VVGLADLLSKHDSQHKLSEVITGDLLIIMA---------QIIIAIQMVLEEKF------VYKHNI 241

  Fly   227 --LKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFK-GYDLFVWY----LVLLQAGG 284
              |:...|..:...|.||||.:|...:......|:   .:|..: ..|.|...    |:.|...|
  Rat   242 HPLQAVGIEGFFGFVILSLLLVPMYYIPTASFSGN---PRGVLEDALDAFCQVGRQPLIALALLG 303

  Fly   285 GLIVAVVVKYAD-NILKGFATSLAIIISCVASIYIFDFNLTLQFS-------FGAGLVIASIFLY 341
            .:.......::. ::.|..:.:..:::..:.::.|:.|.|.|.:.       .|..:::....||
  Rat   304 NISSIAFFNFSGISVTKELSATTRMVLDTLRTVVIWAFTLALGWEVFHPLQILGFLILLMGTALY 368

  Fly   342 G--YDP-----ARSAPKPTMHGPGGDEEKLL 365
            .  :.|     :|....||..   |::|:||
  Rat   369 NGLHRPLLACLSRRWRHPTQE---GEQERLL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 60/324 (19%)
EamA 101..341 CDD:304911 49/260 (19%)
Slc35f6XP_038967844.1 RhaT 81..375 CDD:223769 59/321 (18%)
Nuc_sug_transp <141..>193 CDD:398009 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.