DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35g1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001178564.1 Gene:Slc35g1 / 294072 RGDID:1595908 Length:367 Species:Rattus norvegicus


Alignment Length:210 Identity:54/210 - (25%)
Similarity:81/210 - (38%) Gaps:56/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VQLAQTEGP--------TSGSAGGA---AAAATAASSGGAPEQNRM-----LGLWAALGACFLSG 217
            :|||....|        ..|:.|..   ...|.|..|.|.||..:.     |||:..:.:.||..
  Rat    22 LQLADPASPGEEHVDVEAEGAPGRGRCWPCRAWACGSRGEPEAKKTAPCPGLGLFYTVLSAFLFS 86

  Fly   218 FAGIYFEKI--LKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFF--KGYDLFVWYLV 278
            ...:..:|:  :...|||.:...||: |:.||     |.:...:     ||.  ||..||::   
  Rat    87 VVSLLVKKVQGVHAVEISAFRCVVQM-LVIIP-----CLIYRKT-----GFIGPKGQRLFLF--- 137

  Fly   279 LLQAGGGLIVAVVVKYADNILKGFATSLA----IIISC--VASIY----------IFDFNLTLQF 327
             |:...|....:::.||..     .||||    |..||  ..||:          ::|...||..
  Rat   138 -LRGVFGSSAMILMYYAFQ-----TTSLADATVIAFSCPVFTSIFAWIFLKEKYSLWDAFFTLFA 196

  Fly   328 SFGAGLVIASIFLYG 342
            ..|..|::...||:|
  Rat   197 IAGVILIVRPTFLFG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 53/208 (25%)
EamA 101..341 CDD:304911 52/207 (25%)
Slc35g1NP_001178564.1 RhaT 73..362 CDD:223769 42/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.