DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35b1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_954512.1 Gene:Slc35b1 / 287642 RGDID:727783 Length:322 Species:Rattus norvegicus


Alignment Length:311 Identity:61/311 - (19%)
Similarity:104/311 - (33%) Gaps:84/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSAS-HLDAA 126
            |...:|.:|:         |..:.::...|:....||.:|...........::.||.|. ..::|
  Rat    49 FTFALTLVFI---------QCVINAMFAKILIQFFDTARVDRTRTWLYAACSVSYVGAMVSSNSA 104

  Fly   127 TYQVTYQLKIL-------TTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQL---------AQTE 175
            ...|.|..::|       ...:..|.:|::|....::..:||:|.|:.|...         ..|.
  Rat   105 LQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTV 169

  Fly   176 G----------PTSGSAGGAAAAATAASSGGAPEQNRMLGLWAA--LGACFLSGFAGIYFEKILK 228
            |          ...|..|.:.....|....|:......:.||:.  |||..|  |.|..:|.:..
  Rat   170 GFGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTVLLGAGIL--FTGELWEFLSF 232

  Fly   229 GAEISVWMRNVQLSLLS------------IPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQ 281
            .......:.|:.|..|:            :.||.|||.:...:|    .||              
  Rat   233 AERYPTIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTR----KFF-------------- 279

  Fly   282 AGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAG 332
                .|:|.|:.:|:.|..         :..|.::.:| ..|.|...||.|
  Rat   280 ----TILASVILFANPISS---------MQWVGTVLVF-LGLGLDAKFGKG 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 61/311 (20%)
EamA 101..341 CDD:304911 54/273 (20%)
Slc35b1NP_954512.1 UAA 16..309 CDD:285625 57/302 (19%)
EamA <205..309 CDD:304911 28/137 (20%)
Di-lysine motif 318..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.