DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35a4

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_671481.2 Gene:Slc35a4 / 257647 RGDID:628792 Length:324 Species:Rattus norvegicus


Alignment Length:324 Identity:84/324 - (25%)
Similarity:132/324 - (40%) Gaps:77/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FLSSTAVLMAEFAKLITCLFLVF---------NEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSL 107
            |..|:|||:.|..||:.|.|.:.         ....:.|..|..|                  :|
  Rat    48 FRPSSAVLLTELTKLLLCAFSLLVGWQTWPQGTPPWRQAAPFALS------------------AL 94

  Fly   108 VYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLA 172
            :|...|||:.....::|.:||||...|||.:||:...:.|..:|...|..|||||:         
  Rat    95 LYGANNNLVIYLQRYMDPSTYQVLSNLKIGSTALLYCLCLGHRLSARQGLALLLLM--------- 150

  Fly   173 QTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGA------------------CFLSGFA 219
                         ||.|..||.|.....|.:.|..:|.||                  |.:||.:
  Rat   151 -------------AAGACYASGGFQEPGNTLPGPRSAAGARPMPLHITPLGLLLLILYCLISGLS 202

  Fly   220 GIYFEKILKGAEISVWMRNVQLSLLSIPFGL---LTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQ 281
            .:|.|.|:|...:.:.::|    |....||:   |..:...|.   ..||.:|:..:...:||.|
  Rat   203 SVYTELIMKRQRLPLALQN----LFLYTFGVILNLGLYAGSGP---GPGFLEGFSGWAVLVVLNQ 260

  Fly   282 AGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDP 345
            |..||:::.|:|:..:|.:.|..|.:::::.|.|..:....||..|...|.|:..::.||...|
  Rat   261 AVNGLLMSAVMKHGSSITRLFIVSCSLVVNAVLSAVLLQLQLTATFFLAALLIGLAVCLYYGSP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 82/319 (26%)
EamA 101..341 CDD:304911 68/260 (26%)
Slc35a4NP_671481.2 Nuc_sug_transp <83..320 CDD:398009 71/283 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.