DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SPAC12G12.12

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_592886.1 Gene:SPAC12G12.12 / 2542918 PomBaseID:SPAC12G12.12 Length:324 Species:Schizosaccharomyces pombe


Alignment Length:285 Identity:77/285 - (27%)
Similarity:119/285 - (41%) Gaps:77/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HKTIIANP--MDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKL 151
            ||..:|.|  ||   :|..:|:.:   .|||.|||     .||:|....|:..|:||..:|:|.:
pombe    74 HKVFMALPAIMD---ICGSTLMNV---GLLYTSAS-----IYQMTRGSLIIFVALFATTLLKRTI 127

  Fly   152 LNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAAL-GACFL 215
            ...||.:|..:|:|:.:|          |.:|       ::||.|:   |.:||:.|.| |..||
pombe   128 GQLQWLSLSFVVLGVAIV----------GYSG-------SSSSIGS---NPILGITAVLIGQFFL 172

  Fly   216 S------------------------GFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVN 256
            :                        |..|::|  :|.|..||.:.      :.|...|....|  
pombe   173 ATQFTIEEYILSFIQVDPSELVAYEGTYGVFF--VLLGMIISYYF------IGSTTAGYHGWF-- 227

  Fly   257 DGSRIFDQGFFKGYDLFVWYLVLLQA-----GGGLIVAVVVKYADNILKGFATSLAIIISCVASI 316
            |.|.:..: |.:...|:|...|:|.:     ..||.:..:.......|...|.:..|.|..:| :
pombe   228 DYSHVISR-FNEVPALYVISGVILVSIAFFNVSGLAITKLHSATTRSLLDIARTFGIWIIAMA-M 290

  Fly   317 YIFDFNLTLQFSFGAGLVIASIFLY 341
            .:..|:| ||| .|..|:|..||.|
pombe   291 GMESFHL-LQF-LGFVLLIYGIFTY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 77/285 (27%)
EamA 101..341 CDD:304911 70/269 (26%)
SPAC12G12.12NP_592886.1 Nuc_sug_transp <78..>167 CDD:282054 36/119 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.