DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SPAC22E12.01

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_594827.2 Gene:SPAC22E12.01 / 2541816 PomBaseID:SPAC22E12.01 Length:374 Species:Schizosaccharomyces pombe


Alignment Length:311 Identity:69/311 - (22%)
Similarity:119/311 - (38%) Gaps:64/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IFLSSTAVLM-AEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNN 114
            :||||..:|: ..||||....|..:....||...::...::.         .:|.     :|...
pombe    86 LFLSSCQMLVQMGFAKLTILAFPRYQPNKKDNFSWLEYFYRA---------GICA-----LVTGL 136

  Fly   115 LLYVSASHLDAAT--YQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGP 177
            .:.:|.:.|:..|  :....:..||....|..||.|.::.:  |   :||.:.:|:         
pombe   137 DIGLSNASLETITLSFYTMCRSSILIFVFFFSVIFRIEMFD--W---ILLCITLVI--------- 187

  Fly   178 TSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLS 242
               |||.....||..       |..:.|....:.:..|||......:|:|..   ..|..|...|
pombe   188 ---SAGVVLMVATET-------QFVLSGFLLVMASSVLSGLRWALTQKLLLD---HPWTSNPFTS 239

  Fly   243 LLSIP-----FGLLTCFVNDGS-RIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKG 301
            |.::.     |.|:...:.:|. |..:...:|.:..|:..::|:.  |.|...:|......|.|.
pombe   240 LFALTPLMFLFLLVAGLIFEGPVRFIESPAWKEFGPFMSVVILVP--GTLAFFMVASEFGLIQKT 302

  Fly   302 FATSLAI------IISCVAS-IYIFDFNLTLQFSFGAGLVI--ASIFLYGY 343
            ...:|::      ||:.:|| ::..|..|.:..   .||||  ..|.:|.|
pombe   303 SIVTLSVCGILKEIITIIASTLFYHDILLPINI---VGLVITLCGIGVYNY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 67/308 (22%)
EamA 101..341 CDD:304911 55/256 (21%)
SPAC22E12.01NP_594827.2 TPT 53..349 CDD:281186 67/308 (22%)
EamA 203..350 CDD:304911 35/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.