DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and hut1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_595251.1 Gene:hut1 / 2541206 PomBaseID:SPBC839.11c Length:322 Species:Schizosaccharomyces pombe


Alignment Length:345 Identity:59/345 - (17%)
Similarity:109/345 - (31%) Gaps:109/345 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MAEFAK-LITCLFLVFNEEGKDAQKFV--RSLHKTIIANPMDTLKVCVPSLVYIVQN-------- 113
            ||.|.: |..|:..::.       .|:  ..:.:.||..|.|..:...|:|:.:.|:        
pombe     1 MAGFMRQLFVCMIGIYG-------SFLSWAVMQEKIITRPYDGERFSSPALLSLAQSFMTVLCGL 58

  Fly   114 -----------NLL----------------------YVSASHLDAATYQVTYQLKILTTAMFAVV 145
                       .||                      |.|..||...|..:....|:|......|.
pombe    59 LWNWFHGVSARGLLEPKFLGYFSSIAISASLSSYFGYASMFHLSYPTVILGKSCKLLPVIALHVF 123

  Fly   146 ILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAAL 210
            :.:||....::..:.::..|:.:....|                ..:|.|...|.:..:||....
pombe   124 VYKRKFPPHKYLIVTMITAGVSIFSYFQ----------------NTSSKGKHAEHDSPIGLLLLF 172

  Fly   211 GACFLSGFAGIYFEKILKGAEIS--VWMRNVQLSL-------LSIPFGLLTC------FVNDGSR 260
            ....:.|......:|:....::|  ..|..|.|.:       |..||    |      |:|....
pombe   173 FNLLMDGITNTTQDKVFGKYKLSSVTMMIAVNLGIACLNGLYLISPF----CNQQPLSFINRHPS 233

  Fly   261 IFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIY-----IFD 320
            |...             :||.|..|.:..:.:.:.   |:.|.:...:.|:....|:     :|.
pombe   234 ILKD-------------MLLFACTGSVGQLFIFFT---LEKFGSITLVTITLTRKIFTMLLSVFH 282

  Fly   321 FNLTLQFSFGAGLVIASIFL 340
            |:.|:......|:::  :||
pombe   283 FHHTVSSIQWLGILL--VFL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 59/345 (17%)
EamA 101..341 CDD:304911 49/301 (16%)
hut1NP_595251.1 UAA 7..304 CDD:285625 56/339 (17%)
EamA 188..304 CDD:304911 25/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.