DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SPBC405.03c

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_596306.1 Gene:SPBC405.03c / 2540974 PomBaseID:SPBC405.03c Length:341 Species:Schizosaccharomyces pombe


Alignment Length:262 Identity:53/262 - (20%)
Similarity:98/262 - (37%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLK-ILTTAMFAVVILRR----KLLNTQWGA 158
            :|..|:   ::...|.....|....:.|::.:...:. ..|..:..:|.:.|    |||     |
pombe   106 SLGFCI---IWFAANYFSNSSLGFTNVASFTIISSMSGFFTLGLGTIVNVERFTLSKLL-----A 162

  Fly   159 LLLLVMGIVLV------QLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGAC---- 213
            |:..|.|:::|      |....:.|.|..|.|.|.|..||...|.  .:.|:.......:|    
pombe   163 LMASVGGVIIVVTQDAKQADLNDSPPSRPALGNAYALLAALLYGC--YSVMVKFHITEESCVSTR 225

  Fly   214 FLSGFAGIYFEKILKGAEISVWMRNVQ-LSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYL 277
            ...|..|::...:|....|.:.:..|: .||.|...||:...:|........        ::|.:
pombe   226 LFFGLVGLFDLILLWPFLIILHLYGVERFSLPSTTAGLIVLIINASITFVSD--------YLWVI 282

  Fly   278 VLLQAGGGLIVAV-------VVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVI 335
            .:|.. ..|:|.|       :..:.|.:|||...:.::|:   .|:.:|           ||.::
pombe   283 AMLMT-SPLLVTVGMSLSIPLALFFDILLKGHYLNFSLIL---GSLLVF-----------AGFIV 332

  Fly   336 AS 337
            .:
pombe   333 VN 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 53/262 (20%)
EamA 101..341 CDD:304911 52/260 (20%)
SPBC405.03cNP_596306.1 RhaT 87..339 CDD:223769 53/262 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.