DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and CG30345

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_724760.2 Gene:CG30345 / 246553 FlyBaseID:FBgn0050345 Length:496 Species:Drosophila melanogaster


Alignment Length:365 Identity:78/365 - (21%)
Similarity:127/365 - (34%) Gaps:126/365 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSL---- 107
            ||..:.| ..||.:..|.:.:|           ||....:.|::|.:.........|.|.|    
  Fly    37 RPRSLIL-EPAVFLVFFGRFLT-----------DAVYQNQILYQTCVTVMKYNATECEPFLGTDR 89

  Fly   108 ----VYIVQNNLL-YVSASHLDAATYQVTYQLKILTTAMFAVVIL-----------RRKLLNTQW 156
                |..::..:. |.|.         :|....:|.:.:.|:|.|           |..||:|..
  Fly    90 ASDEVKKIEGQVQEYAST---------ITMISSMLESTVPAIVSLFLGPWSDKFGRRPILLSTFT 145

  Fly   157 GALLLLVMGIVLVQLAQT----------EGPTSGSAGGAAAAAT---AASSGGAPEQN---RMLG 205
            |.|...::.:||.|:...          ....|..:||..|..|   ...|..|.|..   ||:.
  Fly   146 GYLFSAIILVVLTQITTAVNISPWWFLLSSVPSVFSGGTCALITILYCYVSDVATENKRAMRMVT 210

  Fly   206 LWAALGACFLSG-----------FAGIYFEKILKGAEISVWMRNVQLSLLSIPF----GLLTCFV 255
            :.||||...::|           .|.|.|  ||.|:.||:       :||.:.|    .|.:..:
  Fly   211 MEAALGLGMMAGGVASGYIYAATGASILF--ILVGSIISI-------ALLYVYFFVAESLKSEDL 266

  Fly   256 NDGSRIFDQGFFK----------------GYD-LFVWYLVLLQAGGGLIVAVVVKYADNILKGFA 303
            ..||||  :.||:                .|| ..:|::::     .|.:.|.....::.:.   
  Fly   267 ETGSRI--REFFRLDLVKVLVKTCIRKRENYDRAIIWFVMM-----SLTLCVFAMEGESTVN--- 321

  Fly   304 TSLAIIISCVASIYIF---DFNLTLQ-FS-FGAGLVIASI 338
                         |:|   .|:.|:| :| |.|..|:..:
  Fly   322 -------------YMFMRKQFDYTVQDYSVFNAARVVIQV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 78/365 (21%)
EamA 101..341 CDD:304911 67/311 (22%)
CG30345NP_724760.2 MFS_1 102..437 CDD:284993 63/288 (22%)
MFS 121..472 CDD:119392 59/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.