DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35g1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_780716.1 Gene:Slc35g1 / 240660 MGIID:2444789 Length:368 Species:Mus musculus


Alignment Length:314 Identity:63/314 - (20%)
Similarity:119/314 - (37%) Gaps:78/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIA--NPMDTLKVCVPSLVYIV--------QN 113
            :::.|...:..||:          |.|:.:|...|:  ..:..:.|.:|.|:|..        |.
Mouse    79 VLSAFLFSVASLFV----------KKVQGVHAVEISAFRCVVQMLVIIPCLIYRKTGFIGPKGQR 133

  Fly   114 NLLYV------SASHLDAATYQVT---------YQLKILTTAMFAVVILRRKLLNTQWGAL--LL 161
            ..|::      ||..|....:|.|         :...:. |::||.:.|:.|.  :.|.|.  |.
Mouse   134 LFLFLRGVFGSSAMILMYYAFQTTSLADATVIAFSCPVF-TSIFAWIFLKEKY--SLWDAFFTLF 195

  Fly   162 LVMGIVLVQLAQTEGP------TSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAG 220
            .:.|::|:    ...|      |||.....:              ..:.|.:||:|...|:....
Mouse   196 AIAGVILI----VRPPFIFGSDTSGMRESYS--------------EHIKGTFAAIGHAVLAAITL 242

  Fly   221 IYFEKILKGAE--ISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGF-FKGYD-LFVWYLVLLQ 281
            :...|:.|..:  :|:|    ...:|.:|..::..||     |.:... :.|.| ||:..:.||.
Mouse   243 VILRKMGKSVDYFLSIW----YYVILGLPEAIIILFV-----IGEWSLPYCGLDRLFLILIGLLG 298

  Fly   282 AGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVI 335
            .||.:.:...|:.....|.....::.|:.:.:..|..|| |:...::.|..|.:
Mouse   299 LGGQIFITKAVQIEKAGLVAIMKTMDIVFAFIFQIAFFD-NVPTWWTVGGALCV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 63/314 (20%)
EamA 101..341 CDD:304911 56/270 (21%)
Slc35g1NP_780716.1 EamA 72..205 CDD:279264 28/142 (20%)
RhaT 73..362 CDD:223769 63/314 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.