DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SLC35A3

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001258614.1 Gene:SLC35A3 / 23443 HGNCID:11023 Length:367 Species:Homo sapiens


Alignment Length:342 Identity:165/342 - (48%)
Similarity:223/342 - (65%) Gaps:20/342 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RTVNANTLKYISLLTLTLQNAILGLSMRYART--RPGDIFLSSTAVLMAEFAKLITCLFLVFNEE 77
            :|:.|| |||:||..|..|...|.|:|||:||  ..|..:||||||::||..|::.|:.||:.:.
Human    41 KTMFAN-LKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDS 104

  Fly    78 GKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMF 142
            ....:...|.||..|:..||:|||:.:||.:|.:|||||||:.|:||||||||||||||||||:|
Human   105 KCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALF 169

  Fly   143 AVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLW 207
            :|.:|.:||...||.:|::|:.|:..||     .|:.........:|          .::.:||.
Human   170 SVSMLSKKLGVYQWLSLVILMTGVAFVQ-----WPSDSQLDSKELSA----------GSQFVGLM 219

  Fly   208 AALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDL 272
            |.|.|||.|||||:|||||||..:.|||:||:||......|||:..::.||..:...|||:||:.
Human   220 AVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNGFFQGYNR 284

  Fly   273 FVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVAS-IYIFDFNLTLQFSFGAGLVIA 336
            ..|.:|:|||.|||::|.|:||||||||||||||:||:|.:.| .::.||..|..|..||.|||.
Human   285 LTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIILSTLISYFWLQDFVPTSVFFLGAILVIT 349

  Fly   337 SIFLYGYDPARSAPKPT 353
            :.||||||| :.|..||
Human   350 ATFLYGYDP-KPAGNPT 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 156/326 (48%)
EamA 101..341 CDD:304911 118/240 (49%)
SLC35A3NP_001258614.1 Nuc_sug_transp 46..355 CDD:282054 155/324 (48%)
nst 128..354 CDD:129885 118/240 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2778
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D540031at33208
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100998
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R502
SonicParanoid 1 1.000 - - X1127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.700

Return to query results.
Submit another query.