DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and nstp-5

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001255679.1 Gene:nstp-5 / 191452 WormBaseID:WBGene00014139 Length:390 Species:Caenorhabditis elegans


Alignment Length:373 Identity:163/373 - (43%)
Similarity:210/373 - (56%) Gaps:41/373 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ANTLKYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQK 83
            |.|:||.||:.|.:||..|.|.||||.|:....||.:..||..|..|....|.|...|| |...|
 Worm     6 AETIKYSSLVVLVVQNCSLVLFMRYAMTKDRPKFLKTITVLFGEIFKCTVSLLLACIEE-KSIAK 69

  Fly    84 FVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILR 148
            .:|.:|.....|..|||||.|||.:|.|||.||||:..:|.||||.|||||||||||.|.|::|.
 Worm    70 GLRKIHHEFFVNWRDTLKVLVPSAIYTVQNFLLYVAVDNLPAATYMVTYQLKILTTAAFTVLVLH 134

  Fly   149 RKLLNTQWGALLLLVMGIVLVQLAQ-----------------------TEGPTSGSAGGAAAAAT 190
            |:|...||.:|.:|..|:|:||..|                       |..|.|..........|
 Worm   135 RRLTIQQWISLFVLFAGVVVVQYDQKMSNEREKAAAAAVLSSTLAPTTTVSPFSNLTTTLTTVVT 199

  Fly   191 AASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFV 255
            .||...:..:|.:||..|.|.||.|||||||||||||||:.:|:|:||:||:..||.|..|...|
 Worm   200 TASLASSKTENSVLGFIAVLIACVLSGFAGIYFEKILKGSNVSIWIRNIQLAFPSIFFAFLFASV 264

  Fly   256 NDGSRIFDQG---------FFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIIS 311
            .|.|.::..|         ..:|:|..||..|.:.|.|||:||||:||||||||.|||||||:::
 Worm   265 KDNSSLYQDGPNPIEIWNNMLQGFDWAVWVTVAINAFGGLVVAVVIKYADNILKAFATSLAIVLN 329

  Fly   312 CVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARS--------APK 351
            |:|:.::|:|..::.|..||..|||::|.|...|.::        |||
 Worm   330 CIAAYFLFNFRPSILFLVGASGVIAAVFAYSMYPYKASHQALPTDAPK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 158/354 (45%)
EamA 101..341 CDD:304911 124/271 (46%)
nstp-5NP_001255679.1 Nuc_sug_transp 5..360 CDD:282054 158/354 (45%)
EamA 87..359 CDD:304911 124/271 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57961
OrthoDB 1 1.010 - - D540031at33208
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100998
Panther 1 1.100 - - O PTHR10231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.