DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and nstp-7

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_503252.3 Gene:nstp-7 / 187072 WormBaseID:WBGene00019451 Length:356 Species:Caenorhabditis elegans


Alignment Length:332 Identity:123/332 - (37%)
Similarity:190/332 - (57%) Gaps:22/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TLKYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFV 85
            :::.:|::.:|..:..:...::.|..   ..||.:|:|.|.|..||..||.:|..|. :..:|..
 Worm    32 SVQLLSMIAVTTHHTAMPFLVKIANK---SHFLPTTSVFMMEILKLSFCLIIVLIET-RSIRKTA 92

  Fly    86 RSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRK 150
            :.|||.|..|..:|:||.||:|||.|||||.||:.:::||.||.||.||:|||||:.:||:|.:|
 Worm    93 KKLHKNIWQNWWETMKVSVPALVYAVQNNLYYVALANIDATTYSVTLQLRILTTAILSVVLLSKK 157

  Fly   151 LLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFL 215
            |...||.|..:.::|:::|||     ..|.|....|.             |..|||.:.||.|:.
 Worm   158 LSGYQWMAQGMALIGVIVVQL-----DNSNSRREIAG-------------NFWLGLASVLGMCWT 204

  Fly   216 SGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLL 280
            |.|||:||||:||.:...||::|::||:|::.|..:|....||..|.....|.|:...||.:.:.
 Worm   205 SAFAGVYFEKMLKNSSADVWIQNIRLSILTLLFAGITMLSKDGDAIITGNIFHGWTWIVWLVTIG 269

  Fly   281 QAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDP 345
            .:.|||.:::|:|||||::|.:..||||..:.:.||.:.|..|:|...:|..||.:|:.:|...|
 Worm   270 NSIGGLCISLVMKYADNVMKTYCQSLAIGFTSIVSICLGDRLLSLYLGYGVFLVTSSVVVYSLYP 334

  Fly   346 ARSAPKP 352
            |.....|
 Worm   335 ATQPTTP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 119/320 (37%)
EamA 101..341 CDD:304911 97/239 (41%)
nstp-7NP_503252.3 RhaT 35..332 CDD:223769 120/318 (38%)
EamA 108..330 CDD:304911 97/239 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165419
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2778
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D703674at2759
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.