DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and nstp-8

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_503604.2 Gene:nstp-8 / 178698 WormBaseID:WBGene00018414 Length:351 Species:Caenorhabditis elegans


Alignment Length:345 Identity:122/345 - (35%)
Similarity:201/345 - (58%) Gaps:26/345 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TLKYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFV 85
            :::.:|::.:|..:..:...::.|.|   ..||.:|:|.|.|..||:.||.:|..:. |..:|..
 Worm    30 SIQLLSMIAVTAHHTAMPFFVQMANT---SHFLPTTSVFMMEVLKLLFCLIIVLFKT-KSFEKTG 90

  Fly    86 RSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRK 150
            :.|::.|..|.::||||.||::||.:||||.|::.:::||.||.||.||:|||||:.:|:||.:|
 Worm    91 KKLYEHIWKNRVETLKVSVPAVVYAIQNNLYYIALANIDATTYSVTVQLRILTTALLSVIILNQK 155

  Fly   151 LLNTQWGALLLLVMGIVLVQL--AQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGAC 213
            |.|.||.|..:.::|:||||:  :...|...|                    |..||:.|..|.|
 Worm   156 LSNYQWLAQGMALIGVVLVQIDNSNPHGKVFG--------------------NFWLGITAVFGMC 200

  Fly   214 FLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLV 278
            :.|||||:||||:||.:...||::|::||.|::.|..:|....||..:.....|.|::..||::.
 Worm   201 WTSGFAGVYFEKMLKESSADVWVQNIRLSTLTLLFAGITMLSTDGEAVLTGKMFFGWNWIVWFVT 265

  Fly   279 LLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGY 343
            :..:..||.:::|:|||||::|.:..||||.::.:.||::.|..|::...:|..||.:||.:|..
 Worm   266 IGNSIVGLCISLVMKYADNVMKTYCQSLAIGLTAIVSIFLGDRTLSIDLIYGVLLVTSSIVVYSR 330

  Fly   344 DPARSAPKPTMHGPGGDEEK 363
            .||.::.|........|.||
 Worm   331 FPATTSTKYEPLEQDSDAEK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 115/322 (36%)
EamA 101..341 CDD:304911 93/241 (39%)
nstp-8NP_503604.2 Nuc_sug_transp 31..329 CDD:282054 115/321 (36%)
EamA 106..328 CDD:304911 93/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165422
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57961
OrthoDB 1 1.010 - - D703674at2759
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.