DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and nstp-6

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_500371.1 Gene:nstp-6 / 177116 WormBaseID:WBGene00015038 Length:383 Species:Caenorhabditis elegans


Alignment Length:345 Identity:123/345 - (35%)
Similarity:202/345 - (58%) Gaps:31/345 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TLKYISLLTLTLQNAILGLSMRYA-RTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKF 84
            :::.||::.:|..:..:...:|.| :|.    ||.:|:|.|.|..||..||.:...:.| ..:|.
 Worm    34 SVQLISMIAVTAHSTAMPFLVRIANKTH----FLPTTSVFMMEVLKLGFCLIITLFKSG-SIKKT 93

  Fly    85 VRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRR 149
            ...|||||..|.::|:||.||::||.:||||.|::.:::|..||.||.|::|||||..:|.:|.:
 Worm    94 CHELHKTIWQNRLETMKVAVPAVVYAIQNNLYYIALANVDPTTYSVTLQIRILTTAALSVCLLNK 158

  Fly   150 KLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACF 214
            ||...||||.::.::|:|:|||.:|.  :...|.|                |..:|:.|.:|.|:
 Worm   159 KLSWYQWGAQVMALLGVVIVQLDKTN--SHKEAVG----------------NFWIGVSAVVGMCW 205

  Fly   215 LSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVL 279
            .|.|||:||||:||.:...||::|::||:|::.|..:|....||..:|....|:|:...||.:.:
 Worm   206 TSAFAGVYFEKMLKNSSADVWIQNIRLSILTLFFAGITMITTDGEAVFGGRMFEGWSNMVWLVTI 270

  Fly   280 LQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYD 344
            |.:.|||.:::|:|||||::|.:..|:||.::.:.||.:.:..||:...:|..||.:|:.:|...
 Worm   271 LNSVGGLCISLVMKYADNVMKTYCQSIAIGLTSLVSICLGERILTVYLVYGVTLVTSSVVVYSLF 335

  Fly   345 PARSAPKPTMHGPGGDEEKL 364
            |.  || |.:    .|..||
 Worm   336 PV--AP-PAL----SDYHKL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 115/321 (36%)
EamA 101..341 CDD:304911 90/239 (38%)
nstp-6NP_500371.1 Nuc_sug_transp 36..333 CDD:282054 115/319 (36%)
EamA 110..321 CDD:304911 86/228 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.