DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and ugtp-1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_498930.1 Gene:ugtp-1 / 176227 WormBaseID:WBGene00022721 Length:355 Species:Caenorhabditis elegans


Alignment Length:307 Identity:110/307 - (35%)
Similarity:176/307 - (57%) Gaps:18/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LSMRYART--RPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLK 101
            |:::|.|:  .|..::.|::.||.||..||:....:.:.|...|:::|...:.|..|..|.:..|
 Worm    58 LTIKYTRSTVNPDMMYSSTSVVLCAEILKLVITFAMFYKECNFDSRQFSEQVSKYYINAPRELAK 122

  Fly   102 VCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGI 166
            :.|||..|.:||||.:|..|:|||..||||.|||:::||.|.::.|.||....:|.|:.||:.|:
 Worm   123 MSVPSFAYALQNNLDFVGLSNLDAGLYQVTTQLKVVSTAFFMMLFLGRKFSTRRWMAITLLMFGV 187

  Fly   167 VLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILK-GA 230
            ..||:..             .:|:.|::.....:|.::||.|.|..|..:||||:||||:|| |.
 Worm   188 AFVQMNN-------------VSASEANTKRETAENYIVGLSAVLATCVTAGFAGVYFEKMLKDGG 239

  Fly   231 EISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYA 295
            ....|:||:|:....:....:.| :.|.|||.|:|||.||...||.:|:|...|||.:::|::|.
 Worm   240 STPFWIRNMQMYSCGVISASIAC-LTDFSRISDKGFFFGYTDKVWAVVILLGVGGLYISLVMRYL 303

  Fly   296 DNILKGFATSLAIIISCVASIYIF-DFNLTLQFSFGAGLVIASIFLY 341
            ||:.|..|::::||:..|.|:.|| |..:.:.|..|...|:.::.||
 Worm   304 DNLYKSMASAVSIILVVVLSMLIFPDIFIGMYFVLGTICVVLAVLLY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 110/307 (36%)
EamA 101..341 CDD:304911 91/241 (38%)
ugtp-1NP_498930.1 Nuc_sug_transp 37..351 CDD:282054 110/307 (36%)
nst 122..350 CDD:129885 91/241 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D540031at33208
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.