DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and B0041.5

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_491418.1 Gene:B0041.5 / 172075 WormBaseID:WBGene00015009 Length:429 Species:Caenorhabditis elegans


Alignment Length:187 Identity:40/187 - (21%)
Similarity:61/187 - (32%) Gaps:75/187 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 AAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFG 249
            ||.|.|:.||         |.|.::..:.|:..||                              
 Worm   189 AALAFTSVSS---------LNLVSSSSSVFVLAFA------------------------------ 214

  Fly   250 LLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVA 314
              .||.:..:|      |..|...   ||.:...|.|||:       :.:..|..:|...:|.:|
 Worm   215 --ICFPSTNNR------FSAYKCL---LVAINIAGVLIVS-------HYIPSFLGALFAQMSALA 261

  Fly   315 -SIYIFDF--------NLTLQFSFGAGLVIASIF---------LYGYDPARSAPKPT 353
             ::|:|.|        .|.:...|||..|||.:.         .:|.:|....|..|
 Worm   262 YAVYLFAFGHFEEKYGKLDINLMFGAIGVIALVLGTPTLNLLDRFGVEPLHPLPNAT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 36/174 (21%)
EamA 101..341 CDD:304911 36/173 (21%)
B0041.5NP_491418.1 RhaT <223..397 CDD:223769 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.