DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SLC35G1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001128130.1 Gene:SLC35G1 / 159371 HGNCID:26607 Length:365 Species:Homo sapiens


Alignment Length:329 Identity:63/329 - (19%)
Similarity:126/329 - (38%) Gaps:103/329 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIA--NPMDTLKVCVPSLVY------------ 109
            |::.|...:..||:          |.|:.:|...|:  ..:..:.|.:|.|:|            
Human    76 LLSAFLFSVGSLFV----------KKVQDVHAVEISAFRCVFQMLVVIPCLIYRKTGFIGPKGQR 130

  Fly   110 --IVQNNLLYVSASHLDAATYQ---------VTYQLKILTTAMFAVVILRRKLLNTQWGAL--LL 161
              ::...:|..:|..|....||         :|:...:. |::||.:.|:.|.  :.|.||  :.
Human   131 IFLILRGVLGSTAMMLIYYAYQTMSLADATVITFSSPVF-TSIFAWICLKEKY--SPWDALFTVF 192

  Fly   162 LVMGIVLVQL------AQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAG 220
            .:.|::|:..      :.|.|.....:|                  .:.|.:||:|:...:....
Human   193 TITGVILIVRPPFLFGSDTSGMEESYSG------------------HLKGTFAAIGSAVFAASTL 239

  Fly   221 IYFEKILKGAE--ISVWMRNVQ--------LSLL---SIPFGLLTCFVNDGSRIFDQGFFKGYD- 271
            :...|:.|..:  :|:|...|.        ||:|   |:|:    |               |.| 
Human   240 VILRKMGKSVDYFLSIWYYVVLGLVESVIILSVLGEWSLPY----C---------------GLDR 285

  Fly   272 LFVWYLVLLQAGGGLIV--AVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGL- 333
            ||:.::.|...||.:.:  |:.::.|..:  ....::.::.:.:..|..|: |:...::.|..| 
Human   286 LFLIFIGLFGLGGQIFITKALQIEKAGPV--AIMKTMDVVFAFIFQIIFFN-NVPTWWTVGGALC 347

  Fly   334 VIAS 337
            |:||
Human   348 VVAS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 63/329 (19%)
EamA 101..341 CDD:304911 55/285 (19%)
SLC35G1NP_001128130.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
RhaT 70..359 CDD:223769 63/329 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.