DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AgaP_AGAP001214

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_321941.1 Gene:AgaP_AGAP001214 / 1281954 VectorBaseID:AGAP001214 Length:346 Species:Anopheles gambiae


Alignment Length:256 Identity:60/256 - (23%)
Similarity:97/256 - (37%) Gaps:38/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWG-----ALLLLVMGIVLVQLAQT 174
            |.:.:..|:..|...|.    |.:|.:| |.|..|..|....|     .::|.::|:||:    |
Mosquito   109 LSFYAFRHMPLADASVI----IFSTPVF-VAIFARLFLREACGMFNVITIILTLIGVVLI----T 164

  Fly   175 EGPTSGSAGGAAAAATAASSGGAPEQNRMLGLW---AALGACFLSGFAGIYFEKILKGAEISVWM 236
            :.|       ........|............:|   |||.:......|.:.. :.|||...||.|
Mosquito   165 KPP-------FLFGDNLVSIVDEQIMENSYDIWGPVAALSSTLFGANAYVLL-RALKGLHFSVIM 221

  Fly   237 RNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLF-VWYLVLLQAGGGLIVAVVVKYADNILK 300
            .|  ....::.:.||.|:. .|:..:.   ..|.|.| |..|.|...||.:::.:.::|......
Mosquito   222 SN--FGAFALLYTLLVCYY-IGALCWP---LCGTDRFLVIALALFSFGGQILLTLALQYEQAGPV 280

  Fly   301 GFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYD------PARSAPKPTMH 355
            ..|.|..|:.:.:..|..|....:|....||.||::|:.|.|..      |..|..:..:|
Mosquito   281 AIARSADIVFAFIWQIMFFKETPSLYSVLGALLVVSSVVLSGLRKWALALPRDSETRKKLH 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 56/235 (24%)
EamA 101..341 CDD:304911 55/234 (24%)
AgaP_AGAP001214XP_321941.1 RhaT 34..328 CDD:223769 57/241 (24%)
EamA 34..164 CDD:279264 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.