DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AgaP_AGAP001447

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_321679.3 Gene:AgaP_AGAP001447 / 1281727 VectorBaseID:AGAP001447 Length:339 Species:Anopheles gambiae


Alignment Length:261 Identity:51/261 - (19%)
Similarity:101/261 - (38%) Gaps:40/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YIVQNNLLYVSAS-HLDAATYQVTYQLKILTTA-------MFAVVILRRKLLNTQWGALLLLVMG 165
            |...:.|.|:.|. ..:.|...|.|.::::..|       :..|::.|:.....::..:||:|:|
Mosquito    84 YYASSALTYLLAMISSNMALRWVAYPMQVVAKAAKPIPVMLLGVLVGRKSYPMQKYLFVLLIVVG 148

  Fly   166 IVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGA 230
            :||.....::..|                 ||..::..:|....:.:..:.|..|...|::...:
Mosquito   149 VVLFMFKDSKATT-----------------GAVLEHETIGQLLLIMSLSMDGLTGAIQERMRAHS 196

  Fly   231 EISVWMRNVQL-----SLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAG--GGLIV 288
            ..|.  :::.|     |.:.:..|||   |....:.|.....:..:||....:|...|  |.|.:
Mosquito   197 APSA--QHMMLAMNGWSAMIVSVGLL---VTGEGKAFVLFALRHPELFTHLTLLALTGALGQLFI 256

  Fly   289 AVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIF---LYGYDPARSAP 350
            .::|.....:.....|:.....:.:.|:..|...|:.:...||.||...:|   .:|..||.:..
Mosquito   257 FMMVSSFGALACSVVTTTRKFFTVLFSVLFFGNALSGRQWVGAVLVFCGLFADMFFGRKPAPAKE 321

  Fly   351 K 351
            |
Mosquito   322 K 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 47/250 (19%)
EamA 101..341 CDD:304911 47/249 (19%)
AgaP_AGAP001447XP_321679.3 UAA 8..308 CDD:285625 46/245 (19%)
EamA <253..307 CDD:304911 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.