DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AgaP_AGAP005537

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_315538.3 Gene:AgaP_AGAP005537 / 1276221 VectorBaseID:AGAP005537 Length:516 Species:Anopheles gambiae


Alignment Length:395 Identity:86/395 - (21%)
Similarity:126/395 - (31%) Gaps:137/395 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SYSHRTVNANTLKYISLLTLTLQNAILGLSMRYA-----RTRPGDIFLSSTAVLMAEFAKLITCL 70
            ||.|..      :||...|       .|.|..||     .||....|.:...|.:.    ||.|.
Mosquito    49 SYGHHN------QYIVTTT-------AGGSKSYADGGGGDTRKKHAFTNRIVVTLV----LIVCY 96

  Fly    71 F-----LVFNE----EGKDAQKFVRSLH---KTIIANPMDTLKVCV-----------PSLVYIVQ 112
            |     |.|.:    :......||...|   |.::|..:..:..||           .|:..|:.
Mosquito    97 FSLSIGLTFYQRHLLQHFKLPLFVVLYHLVIKLLLAAAVRAVLRCVTRKPRILLDWRTSVRKILP 161

  Fly   113 NNLLYVSASHLD------------AATYQVTYQLKILTTAMFAVVILRRKLLNTQW--GALLLLV 163
            ..|    ||.:|            .:.|.:|....|:...:||:::   ||....|  ||:::::
Mosquito   162 TGL----ASGIDISFSNWGLELVKISLYTMTKSTTIVFILIFAILL---KLEKKSWSLGAIVVMI 219

  Fly   164 MGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAP-------EQNRMLGL------------WAA 209
            .|.:.:   .|...|...|.|.:....|:.|.|..       .|...|||            |..
Mosquito   220 SGGLFM---FTYKSTQFDALGFSFLLFASLSSGIRWTFAQLIMQKSKLGLHNPIDMIFHMQPWMI 281

  Fly   210 LGAC-FLSGFAGIYFEKILKGAE----------ISVWMRNVQLSLLSIPFGLLTCFVNDGSR--- 260
            |... |..||.|   .|:|:|.:          :.:|.:        |..|....|..:.|.   
Mosquito   282 LSVLPFTIGFEG---RKLLEGYDLVQQLPSAVVVDMWAK--------ISIGAFIAFAMEVSEFMV 335

  Fly   261 --------IFDQGFFK-------GYDL------FVWYLVLLQAGGGLIVAVVVK---YADNILKG 301
                    :...|.||       ..:|      .|..|.|:...||:...||.|   |.|...|.
Mosquito   336 LTNTSSLTLSVAGIFKEICQLILAVELNDEHLSTVNVLGLVMCLGGICCHVVHKFLTYRDETTKS 400

  Fly   302 FATSL 306
            ..:||
Mosquito   401 TLSSL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 83/388 (21%)
EamA 101..341 CDD:304911 61/288 (21%)
AgaP_AGAP005537XP_315538.3 TPT 88..385 CDD:281186 65/321 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.