DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AgaP_AGAP003549

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_313297.3 Gene:AgaP_AGAP003549 / 1274209 VectorBaseID:AGAP003549 Length:383 Species:Anopheles gambiae


Alignment Length:353 Identity:68/353 - (19%)
Similarity:141/353 - (39%) Gaps:90/353 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KYISLLTLTLQNAILGLSMRYA-----RTRPGDI------FLSSTAVLMAEFAKLITCLFLVFNE 76
            ::|..||:.:..:|..||.::|     ....|.:      |:.:.|:.:.||..|:....:.::.
Mosquito     7 QFIFALTMVVTGSINTLSTKWADNIESEGSDGQVRRFVHPFVQACAMFLGEFLCLLAFKAVYYHL 71

  Fly    77 EGKDAQKFVRSLHKTIIAN-PMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQL----KI 136
            ..|:.....|  |..:..| ......:.||::..::..:::||..:    .||..::||    .|
Mosquito    72 RRKNNGSEDR--HDLVQGNREFSPFILFVPAMCDMLATSIMYVGLN----LTYPSSFQLLRGSVI 130

  Fly   137 LTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQN 201
            :..|:.:|..|.|.|:..:|..:..:::|:|:|              |.:...:..::|....:|
Mosquito   131 IFVAILSVAFLNRTLVKREWFGIAFIMVGLVIV--------------GMSDVLSNDNTGSQYTRN 181

  Fly   202 RMLGLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGF 266
            .:           ::|...|...:|:  ..:.:......::.|:|| .|        ..:..:||
Mosquito   182 NV-----------ITGDLLIILAQII--TAVQMVYEEYYVTALNIP-AL--------QAVGWEGF 224

  Fly   267 FKGYDLFVWYLVLLQAGGGLIVA---VVVKY-----ADNILKGFATSLA---------IIIS-CV 313
            | |:.:.          |.|::.   :.|.|     |..:|:....:||         |.|| .:
Mosquito   225 F-GFSVL----------GALLLPMYFIHVMYPFNSNAHGVLEDLPDALAQMANNYQLIIAISGMI 278

  Fly   314 ASIYIFDF---NLTLQFSFGAGLVIASI 338
            .||..|:|   ::|.:.|....:|:.|:
Mosquito   279 VSIAFFNFAGISVTKEISATTRMVLDSV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 68/353 (19%)
EamA 101..341 CDD:304911 51/263 (19%)
AgaP_AGAP003549XP_313297.3 Nuc_sug_transp 47..>205 CDD:282054 33/190 (17%)
EamA <88..165 CDD:304911 19/94 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.