DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and AgaP_AGAP006969

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_308788.3 Gene:AgaP_AGAP006969 / 1270116 VectorBaseID:AGAP006969 Length:440 Species:Anopheles gambiae


Alignment Length:337 Identity:77/337 - (22%)
Similarity:118/337 - (35%) Gaps:115/337 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPAPVTYSYS---HRTVNANTLKYISLLTLTL---QNAILGLSMRYARTRPGDIFLSS----TAV 58
            |.:.::|:.|   ||..:.:.....:||...|   .|.:..|::..:.|....:..||    |.:
Mosquito   142 LMSRLSYAASLRVHRQKSHHKTARTALLFCVLWFIANYMFQLALEPSETAMVTLLSSSSSFFTLI 206

  Fly    59 LMAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHL 123
            |.|.|..  :|           ..||              |...|...|:.|  :..:.||.|.:
Mosquito   207 LAAMFPS--SC-----------GDKF--------------TFSKCFAVLLSI--SGAVMVSMSEI 242

  Fly   124 DAATYQVTYQLKILTTAMFA--VVILRRKLLNTQ--------------WGALLLLVMGIVL--VQ 170
            |.........|.:|:...:|  :|:::|| .:|:              |..|||..:..||  .|
Mosquito   243 DQPKMSRGIVLALLSAFFYASYLVLVKRK-SDTEEKISIPLFFGFVGLWNLLLLWPLLFVLNFSQ 306

  Fly   171 LAQTEGPT---------SGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEKI 226
            |...|.|:         :|..|...:.|                ||  |..|||:          
Mosquito   307 LEVFELPSRRQFIVLFLNGLIGTVLSEA----------------LW--LWGCFLT---------- 343

  Fly   227 LKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLI-VAV 290
                  |..:..|.:| |.||..:|...|..|         |.|.| ::||..|.....|: ||.
Mosquito   344 ------SSLIGTVAIS-LQIPLAMLFDMVLHG---------KTYPL-LFYLGSLPMFLSLVLVAF 391

  Fly   291 VVKY--ADNILK 300
            :||:  .|.:||
Mosquito   392 LVKFDDCDPLLK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 72/320 (23%)
EamA 101..341 CDD:304911 56/230 (24%)
AgaP_AGAP006969XP_308788.3 RhaT 152..391 CDD:223769 68/313 (22%)
EamA 249..391 CDD:279264 43/187 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.