DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35a2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_031746837.1 Gene:slc35a2 / 116406619 -ID:- Length:405 Species:Xenopus tropicalis


Alignment Length:336 Identity:165/336 - (49%)
Similarity:222/336 - (66%) Gaps:19/336 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LKYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVR 86
            |||:||..|.:|||.|.||:|||||.||:.|.|:|||:|||..|.||||.|:..:...:.::...
 Frog    70 LKYVSLAVLVVQNASLILSIRYARTLPGERFFSTTAVVMAEILKGITCLALMLVQRRGNVKELGL 134

  Fly    87 SLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKL 151
            .|:..|:...|||||:.||||:|.:||||.||:.|:|.|||:||||||||||||:|:|::||:.|
 Frog   135 FLYDAIVVQYMDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLLLRKSL 199

  Fly   152 LNTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLS 216
            ...|||:|:||..|:.:||..|:.|..:...||               |:..:||.|...:|..|
 Frog   200 SRLQWGSLVLLFGGVAIVQAEQSGGKETVGGGG---------------QSYGVGLVAVAVSCLSS 249

  Fly   217 GFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQ 281
            ||||:|||:||||:..|||:|||||.:.....|||..:..||:.:...|||.||...||.::..|
 Frog   250 GFAGVYFERILKGSSASVWLRNVQLGIFGTALGLLAMWQQDGAAVAQHGFFHGYTPLVWGVIFNQ 314

  Fly   282 AGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGY--- 343
            |.|||:|||||||||||||||||||:|::|..||:::|.|::.:.|:.||.|||.:::||..   
 Frog   315 AFGGLLVAVVVKYADNILKGFATSLSIVVSTAASVHLFGFHVDIPFALGAALVIGAVYLYSLPRK 379

  Fly   344 -DPARSAPKPT 353
             |.|.|....|
 Frog   380 PDSASSCAAQT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 160/319 (50%)
EamA 101..341 CDD:304911 120/239 (50%)
slc35a2XP_031746837.1 Nuc_sug_transp 68..375 CDD:398009 160/319 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 307 1.000 Domainoid score I1350
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 307 1.000 Inparanoid score I2594
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.