DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SLC35A4

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_542401.1 Gene:SLC35A4 / 113829 HGNCID:20753 Length:324 Species:Homo sapiens


Alignment Length:335 Identity:92/335 - (27%)
Similarity:147/335 - (43%) Gaps:56/335 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTLTLQNAILG-----LSMRYARTR-PGDIFLSSTAVLMAEFAKLITCLFLVFN-----EEG--- 78
            |.|.|..|:.|     |::.:...| |   |..|:|||:.|..||:.|.|.:..     .:|   
Human    21 LMLLLSTAMYGAHAPLLALCHVDGRVP---FRPSSAVLLTELTKLLLCAFSLLVGWQAWPQGPPP 82

  Fly    79 -KDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMF 142
             :.|..|..|                  :|:|...|||:.....::|.:||||...|||.:||:.
Human    83 WRQAAPFALS------------------ALLYGANNNLVIYLQRYMDPSTYQVLSNLKIGSTAVL 129

  Fly   143 AVVILRRKLLNTQWGALLLLVMGIVLVQLA---QTEGPTSGSAGGAAAAATAASSGGAPEQNRML 204
            ..:.||.: |:.:.|..|||:|.......|   |..|.|..|...||||:.      .|.....|
Human   130 YCLCLRHR-LSVRQGLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASP------MPLHITPL 187

  Fly   205 GLWAALGACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLT---CFVNDGSRIFDQGF 266
            ||...:..|.:||.:.:|.|.::|...:.:.::|    |....||:|.   .....||   ..|.
Human   188 GLLLLILYCLISGLSSVYTELLMKRQRLPLALQN----LFLYTFGVLLNLGLHAGGGS---GPGL 245

  Fly   267 FKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGA 331
            .:|:..:...:||.||..||:::.|:|:..:|.:.|..|.:::::.|.|..:....||..|....
Human   246 LEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAVLLRLQLTAAFFLAT 310

  Fly   332 GLVIASIFLY 341
            .|:..::.||
Human   311 LLIGLAMRLY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 92/335 (27%)
EamA 101..341 CDD:304911 68/245 (28%)
SLC35A4NP_542401.1 Nuc_sug_transp <83..320 CDD:282054 71/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.