DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Slc35b3

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_006516590.1 Gene:Slc35b3 / 108652 MGIID:1913978 Length:444 Species:Mus musculus


Alignment Length:278 Identity:55/278 - (19%)
Similarity:86/278 - (30%) Gaps:87/278 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VPSLVYIV-------QNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLN-TQWGALL 160
            :|...|::       ...|...|..:|:..| ||.::...|...|...|.::.|..| ....|.:
Mouse   184 IPGKTYMLIAFLTVGTMGLSNTSLGYLNYPT-QVIFKCCKLIPVMLGGVFIQGKRYNLADVSAAV 247

  Fly   161 LLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSGFAGIYFEK 225
            .:.:|::..                    |.|.|..||..|....:..:|..| .....|...||
Mouse   248 CMSLGLIWF--------------------TLADSTIAPNFNLTGVMLISLALC-ADAVIGNVQEK 291

  Fly   226 ILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAV 290
            .:|....|    |.::.|.|...|                       ||:.|:.|....||..||
Mouse   292 AMKLHNAS----NSEMVLYSYSIG-----------------------FVYILLGLSCTSGLGPAV 329

  Fly   291 V-----------------------VKYADNILKGFATSLAIII-------SCVASIYIFDFNLTL 325
            .                       :.:...::|.|...||:.:       :.|.|...|....|.
Mouse   330 AFCSKNPVGTYGYAFLFSLTGYFGISFVLALIKIFGALLAVTVTTGRKAMTVVLSFLFFAKPFTF 394

  Fly   326 QFSFGAGLVIASIFLYGY 343
            |:.:...||:..|||..|
Mouse   395 QYIWSGLLVVLGIFLNVY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 54/275 (20%)
EamA 101..341 CDD:304911 53/274 (19%)
Slc35b3XP_006516590.1 UAA 92..414 CDD:312076 55/278 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.