DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and Mfsd14a

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001316129.1 Gene:Mfsd14a / 103689987 RGDID:9294064 Length:490 Species:Rattus norvegicus


Alignment Length:321 Identity:67/321 - (20%)
Similarity:108/321 - (33%) Gaps:75/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVT 131
            :..:||.|...|......:..||:|.   |..|.  .:..|:..|:..|.::||..:.|.:....
  Rat    41 VIVIFLEFFAWGLLTAPTLVVLHETF---PKHTF--LMNGLIQGVKGLLSFLSAPLIGALSDVWG 100

  Fly   132 YQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQLAQ--------TEGPTSGSAGGAAAA 188
            .:..:|.|..|....:....::..|...::.|.|:..|..:.        |:......|.|..:|
  Rat   101 RKSFLLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAYGLVSA 165

  Fly   189 ATAASSGGAPEQNRMLG-------------LWAALGACF-LSGFAGIYFEKILK---GAEISVWM 236
            ..|||...:|.....||             ..|.|..|| |........||:..   ||.|| |.
  Rat   166 TFAASLVTSPAIGAYLGRVYGDSLVVVLATAIALLDICFILVAVPESLPEKMRPASWGAPIS-WE 229

  Fly   237 RNVQLSLLSIPFG-----------LLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAV 290
            :       :.||.           ||.|.....|.:.:.|.:..:     :|.|.|         
  Rat   230 Q-------ADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYSSF-----FLYLRQ--------- 273

  Fly   291 VVKYADNILKGFATSLAIIISCVASIYIFDF--------NLTLQFSFGAGLVIASIFLYGY 343
            ::|::...:..|...|. |:|.:|...:...        |..|   .|.|..|..:..||:
  Rat   274 IMKFSPESVAAFIAVLG-ILSIIAQTIVLSLLMRSIGNKNTIL---LGLGFQILQLAWYGF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 65/318 (20%)
EamA 101..341 CDD:304911 56/283 (20%)
Mfsd14aNP_001316129.1 MFS 40..397 CDD:119392 67/321 (21%)
MFS_1 42..386 CDD:284993 67/320 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.