DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and SLC35B1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_006721695.1 Gene:SLC35B1 / 10237 HGNCID:20798 Length:393 Species:Homo sapiens


Alignment Length:321 Identity:64/321 - (19%)
Similarity:106/321 - (33%) Gaps:96/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EFAKLITCLF---LVFNEEGKDAQKFVRSLHKTIIANPMDTLKV-CVPSLVYIVQNNLLYVSASH 122
            |.||..|..|   |||      .|..:.::...|:....||.:| ...|.:|..      .|.|:
Human   113 EGAKQETFTFALTLVF------IQCVINAVFAKILIQFFDTARVDRTRSWLYAA------CSISY 165

  Fly   123 LDA------ATYQVTYQLKIL-------TTAMFAVVILRRKLLNTQWGALLLLVMGIVLVQL--- 171
            |.|      |...|.|..::|       ...:..|.:|::|....::..:||:|.|:.|...   
Human   166 LGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPK 230

  Fly   172 ------AQTEG----------PTSGSAGGAAAAATAASSGGAPEQNRMLGLWAAL---------- 210
                  ..|.|          ...|..|.:.....|....|:......:.||:.|          
Human   231 KVVGIEEHTVGYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTLLLGMGILFTG 295

  Fly   211 ----GACFLSGFAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYD 271
                ...|...:..|.:..:|.|...::....:.:::  :.||.|||.:...:|    .||    
Human   296 ELWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTV--VYFGPLTCSIITTTR----KFF---- 350

  Fly   272 LFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAG 332
                          .|:|.|:.:|:.|..         :..|.::.:| ..|.|...||.|
Human   351 --------------TILASVILFANPISP---------MQWVGTVLVF-LGLGLDAKFGKG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 64/321 (20%)
EamA 101..341 CDD:304911 52/279 (19%)
SLC35B1XP_006721695.1 UAA 53..380 CDD:312076 60/312 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.