Sequence 1: | NP_001138149.1 | Gene: | Ugalt / 31255 | FlyBaseID: | FBgn0024994 | Length: | 368 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005162180.1 | Gene: | LOC101884357 / 101884357 | -ID: | - | Length: | 1587 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 43/205 - (20%) |
---|---|---|---|
Similarity: | 78/205 - (38%) | Gaps: | 31/205 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LPAPVTYSY---SHRTVNANTLKYISLLTLTLQNAILGLSMR--YARTRPGDI----FLSSTAVL 59
Fly 60 MAEFAKLITCLFLVFNEEGKDAQKFVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLD 124
Fly 125 AATYQVTYQLKILTTAMFAVVILRRKLLNTQW-GALLLLVMGIVLVQLAQTEGPTSGSAGGAAAA 188
Fly 189 ATAASSGGAP 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ugalt | NP_001138149.1 | Nuc_sug_transp | 18..342 | CDD:282054 | 37/188 (20%) |
EamA | 101..341 | CDD:304911 | 22/99 (22%) | ||
LOC101884357 | XP_005162180.1 | fn3 | 51..121 | CDD:278470 | |
vWA_collagen_alphaI-XII-like | 265..428 | CDD:238759 | |||
fn3 | 467..544 | CDD:278470 | |||
FN3 | 559..636 | CDD:214495 | |||
FN3 | 651..734 | CDD:238020 | 17/100 (17%) | ||
FN3 | 738..825 | CDD:238020 | 17/89 (19%) | ||
fn3 | 831..910 | CDD:278470 | 1/1 (100%) | ||
fn3 | 934..996 | CDD:278470 | |||
LamG | 1037..1230 | CDD:304605 | |||
Collagen | 1267..1331 | CDD:189968 | |||
Collagen | 1347..1406 | CDD:189968 | |||
Collagen | 1507..1565 | CDD:189968 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0697 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |