DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and wdr35

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_002934527.2 Gene:wdr35 / 100496375 XenbaseID:XB-GENE-985175 Length:1181 Species:Xenopus tropicalis


Alignment Length:112 Identity:23/112 - (20%)
Similarity:42/112 - (37%) Gaps:39/112 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 GAPEQNRMLGLWAALGACFLSGFAGIYFEKILKGAEIS--VWMRNVQLSLLSIPFGLLTCFVNDG 258
            |:.:.||:.|                   |.|||.::.  .|..:.::.|..:..|.:..:.|.|
 Frog   142 GSVDGNRIWG-------------------KELKGIQLCHVAWSPDSKILLFGMANGEIHLYDNQG 187

  Fly   259 SRIFDQGFFKGYDLFVWYLV---LLQAGGGLIVAVVVKYADNILKGF 302
            :             |:..:|   |:...|.|.:|.:..|:.|  ||:
 Frog   188 N-------------FIVKMVLSCLVNVSGALSIAGMHWYSGN--KGY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 23/112 (21%)
EamA 101..341 CDD:304911 23/112 (21%)
wdr35XP_002934527.2 WD40 repeat 18..69 CDD:293791
WD40 <19..215 CDD:225201 20/104 (19%)
WD40 repeat 74..111 CDD:293791
WD40 repeat 119..157 CDD:293791 7/33 (21%)
WD40 repeat 159..196 CDD:293791 7/49 (14%)
WD40 repeat 253..300 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 1 1.000 - - otm48462
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R502
SonicParanoid 1 1.000 - - X1127
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.