DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35a5

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_031752663.1 Gene:slc35a5 / 100490140 XenbaseID:XB-GENE-1003413 Length:441 Species:Xenopus tropicalis


Alignment Length:395 Identity:101/395 - (25%)
Similarity:171/395 - (43%) Gaps:65/395 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YISLLTLTLQNAILG----LSMRYARTRPGDI-FLSSTAVLMAEFAKLITCLFLVFNEEGKDAQK 83
            |:..|.|......||    |.::::....... ::.:|..:.||..||:.|:.:......|:.:.
 Frog    44 YLHTLLLAFAYVSLGSSRVLLVKFSANEDNTYDYVPTTVNVCAEAVKLLFCMVMSVRIIMKERRS 108

  Fly    84 FVRSLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILR 148
            |  ..|.: :......:|..||:.:|.:.|.:::...::|..|...:.....|:|||.|...||:
 Frog   109 F--RCHAS-LKEFFQYMKWAVPAFLYFLDNLIIFYILAYLQPAMAVLLSNFVIITTAFFFRFILK 170

  Fly   149 RKLLNTQWGALLLLVMGIVLVQLAQTEGPTS------------------GSAGGAAA-------- 187
            |:|...||.:||:|.:.|:        |.||                  .||...:.        
 Frog   171 RQLSCVQWASLLILFLSIM--------GLTSQNDTAHQEVSVNIHHHLFHSAPSNSCIYPKKLDT 227

  Fly   188 -AATAASSGGAPEQNRMLGL--WAALGACFLSGFAGIYFEKILK-GAEI--SVWMRNVQLSLLSI 246
             |.|.:....|..|...||:  :..|..|.:|..|.||.||||| |.:|  |::::|.:|.:..:
 Frog   228 EAHTVSLKAIANFQYFHLGIGHFLILLQCVISALANIYNEKILKEGEQISESIFIQNSKLYVFGV 292

  Fly   247 PFGLLTCFVNDG--SRIFDQGFFKGYDLFVWYLVLLQAGGGLIVAVVVKYADNILKGFATSLAII 309
            .|..||..:::.  |:|...|||.|::.|...|:...|..||.||.::|:.||:.......|..:
 Frog   293 LFNGLTLVLHEEHFSKIKSCGFFYGHNGFSIALIFSTAFVGLTVAFILKFRDNMFHVLTAQLTTV 357

  Fly   310 ISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPARSAPKPTM---------------HGPGG 359
            |..:.|.::|:|..:|.|...|.:|:.||::|.......:...|.               :|.|.
 Frog   358 IITIVSYFVFNFKPSLDFFLEAPVVLLSIYIYNASRITDSSGATQREKFQIINGDVWERSNGDGQ 422

  Fly   360 DEEKL 364
            :.|||
 Frog   423 ELEKL 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 94/356 (26%)
EamA 101..341 CDD:304911 79/273 (29%)
slc35a5XP_031752663.1 Nuc_sug_transp 52..390 CDD:398009 91/348 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D703674at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.