DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and plod2

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:XP_004914412.1 Gene:plod2 / 100489636 XenbaseID:XB-GENE-1006449 Length:761 Species:Xenopus tropicalis


Alignment Length:163 Identity:38/163 - (23%)
Similarity:55/163 - (33%) Gaps:43/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCL--------FLVFNEEGKDAQKFV 85
            |..|....|..:..|.:...| ||:......:.||...:..|        |.:.|.|....|..|
 Frog   284 TCDLDTTDLSTANAYPKVTVG-IFIEQPTPFLPEFFNRLLALDYPKENMNFFIHNSEVYHEQHIV 347

  Fly    86 R--SLHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSAS-----------------HLDAATYQVT 131
            :  ...|.:|.|    |||..|      :..::...|.                 ::||......
 Frog   348 KFWEQAKNVIGN----LKVVGP------EEPIMQAEARNMGMNTCRQDKECDYYFNIDADVMLTN 402

  Fly   132 YQ-LKIL---TTAMFAVVILRR-KLLNTQWGAL 159
            .| ||||   ...:.|.::.|. ||.:..||||
 Frog   403 PQTLKILIEQNRKIIAPLVTRHGKLWSNFWGAL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 38/163 (23%)
EamA 101..341 CDD:304911 19/81 (23%)
plod2XP_004914412.1 P4Hc 596..759 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.