DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugalt and slc35a1

DIOPT Version :9

Sequence 1:NP_001138149.1 Gene:Ugalt / 31255 FlyBaseID:FBgn0024994 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001122283.1 Gene:slc35a1 / 100004536 ZFINID:ZDB-GENE-080716-17 Length:337 Species:Danio rerio


Alignment Length:344 Identity:138/344 - (40%)
Similarity:201/344 - (58%) Gaps:20/344 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KYISLLTLTLQNAILGLSMRYARTRPGDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDAQKFVRS 87
            |...|..:||..|...:::||.||...:::.|:|||.:||..||:..|.::..|.| |..:...:
Zfish    11 KLYCLTVMTLIAATYTVALRYTRTVSTELYFSTTAVCLAEIIKLLLSLIMLVRETG-DVGRCRAA 74

  Fly    88 LHKTIIANPMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLL 152
            |...|..:|.:.||:.|||:||.:|||:.:|:.|:||||.|||||||||..||:..|::|.|.|.
Zfish    75 LVTHIFRSPKELLKLSVPSVVYAIQNNMAFVALSNLDAAVYQVTYQLKIPCTALCTVLMLNRSLS 139

  Fly   153 NTQWGALLLLVMGIVLVQLAQTEGPTSGSAGGAAAAATAASSGGAPEQNRMLGLWAALGACFLSG 217
            ..||.::.:|..|:.|||.....                 |:....|||..||..|...|...||
Zfish   140 RLQWFSVFMLCAGVTLVQWTPPH-----------------STKVQVEQNPFLGFMAIAVAVLCSG 187

  Fly   218 FAGIYFEKILKGAEISVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQGFFKGYDLFVWYLVLLQA 282
            |||:||||:||.::.|:|:||:|:.|..|...|:..::.||:|:.::|||.||..:|..:|.|.:
Zfish   188 FAGVYFEKVLKSSDTSLWVRNIQMYLSGIAVTLMGVYMTDGARVLEKGFFYGYTPWVCLVVFLAS 252

  Fly   283 GGGLIVAVVVKYADNILKGFATSLAIIISCVASIYIFDFNLTLQFSFGAGLVIASIFLYGYDPAR 347
            .||:..:|||||.|||:|||:.:.||::|.|||:.:|...:||.|..||.||..||:|||. |.:
Zfish   253 VGGMYTSVVVKYTDNIMKGFSAAAAIVLSTVASVLLFGLQITLTFISGALLVCVSIYLYGL-PKQ 316

  Fly   348 SAPKPTMHGPGGDE-EKLL 365
            ...|....|...|: .||:
Zfish   317 DTTKVMKAGAEQDDTHKLI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UgaltNP_001138149.1 Nuc_sug_transp 18..342 CDD:282054 130/318 (41%)
EamA 101..341 CDD:304911 104/239 (44%)
slc35a1NP_001122283.1 Nuc_sug_transp 6..312 CDD:282054 130/318 (41%)
nst 88..311 CDD:129885 104/239 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D540031at33208
OrthoFinder 1 1.000 - - FOG0000573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.