DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and Samd7

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_083765.2 Gene:Samd7 / 75953 MGIID:1923203 Length:445 Species:Mus musculus


Alignment Length:290 Identity:69/290 - (23%)
Similarity:112/290 - (38%) Gaps:76/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 TLKQSKAVE-ANPNW------RCFRCEACNIGGSTSASSEEQTGA-----RKSTASREDQAQPVV 270
            :|.|.:.:| .||..      ..|...:| :||.|.........|     .:|| .|..|..|::
Mouse   108 SLYQQRRMERVNPKGLSGLGIPLFYGSSC-LGGPTGFQGRSTLPASDVHLHRST-FRHLQGNPIL 170

  Fly   271 ----PRKSNA-GRKKRV------QSEPTGQEKAAK--IEKLAKRRQPLKTEKKKEYKKEED-EEP 321
                |..:.. |:|.|:      |..|....::.|  .|:.:..:.|..:.:::||.|:.| |..
Mouse   171 LATRPHFTECWGQKYRLRRGAVYQKPPESDTESFKSQAEEKSSSQMPTLSYEEEEYIKDPDIEVD 235

  Fly   322 AQIKVKVEKVEPV--------DMETEQ-----IENN---DLPGPEQESL------------SLRL 358
            .|.|.:|...:|.        ::.|.|     :|.|   |..|...|.:            .:.:
Mouse   236 NQQKPRVADGKPTTVPANPHGELHTHQRKPSSLEANAWDDGKGKPSEQVYEGCDGKNGVFRPVSI 300

  Fly   359 TPITAVERR--------SHPVSTWSVEQVVQFVAKRYP---KEANVFRYQDIDGASLLLLNRHDV 412
            .|::....:        ...:..|:|:.|..|: :..|   ..|.||:...|||.:|.||....:
Mouse   301 LPLSGTHEQVALRENCSLSDIQKWTVDDVYNFI-RSLPGCSDYAQVFKDHAIDGETLPLLTEQHL 364

  Fly   413 MNGFGLKLGPALRVFELVMSLQTQ-SNDVG 441
            ....||||||||::       |:| |..||
Mouse   365 RGTMGLKLGPALKI-------QSQVSQHVG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584
PHD 189..236 CDD:214584 6/24 (25%)
SAM_Atherin-like 371..438 CDD:188982 24/70 (34%)
SAM 371..436 CDD:197735 23/67 (34%)
Samd7NP_083765.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..282 20/88 (23%)
SAM_Samd7,11 321..388 CDD:188978 27/75 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..445
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.