DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lint-O and Samd13

DIOPT Version :10

Sequence 1:NP_570018.1 Gene:Lint-O / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_083420.2 Gene:Samd13 / 75015 MGIID:2686498 Length:234 Species:Mus musculus


Alignment Length:135 Identity:35/135 - (25%)
Similarity:51/135 - (37%) Gaps:31/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 VPRKSNAGRKKR------VQSEP---TGQEKAA--KIEKLAKRRQPLK-TEKKKEY-------KK 315
            |||.:::...||      :|..|   .|.::||  |.:::|:....|. .:|:|:|       .|
Mouse    10 VPRNASSSDIKRAFHQLALQVHPDKNPGDKEAAEEKFKQVAEAYHILSDAKKRKDYDRSRWNRNK 74

  Fly   316 EEDEEPAQIKVKVEKVEPVDMETEQIENNDLPGP--------EQESL----SLRLTPITAVERRS 368
            .|.......|.:..:|.....||:..|......|        |.|.|    .|...|||...|.|
Mouse    75 GEIRGDGHDKGETIRVNDSRDETDWEEKICSRRPRHTFQKVTEDEDLFSGDCLFSGPITGSRRAS 139

  Fly   369 HPVST 373
            .|..|
Mouse   140 SPFFT 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lint-ONP_570018.1 PHD 134..187 CDD:214584
PHD 189..236 CDD:214584
SAM_Atherin-like 371..438 CDD:188982 1/3 (33%)
Samd13NP_083420.2 DnaJ 3..66 CDD:395170 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.