DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and ph-d

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_524794.2 Gene:ph-d / 44889 FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster


Alignment Length:508 Identity:105/508 - (20%)
Similarity:160/508 - (31%) Gaps:206/508 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKDEDKEESPVQPTTHNSSAG------------------------SNG----HDAKSPVVTTAPA 40
            ||..:....|...|..||.:|                        :||    ....|..|:||..
  Fly  1150 SKQSNAAVQPPSSTIPNSVSGKEEPKLTTCGSLTSATSTSTTTTITNGIGVARTTASTAVSTAST 1214

  Fly    41 ATCSVSVSDASGAGASVRTTGRVKK-----PKQVYDPS------DNYVSRASSNRNSLSSVPATS 94
            .|.|......|....:..||..:..     ||.:..|:      |.::.:.::     ...|.|.
  Fly  1215 TTTSSGTFTTSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVIDGFIIQEAN-----EPFPVTR 1274

  Fly    95 N-------VQSPPVKEATDSQDSTTSPVSEQQQQQLQQAAQLRNFDTCQKCGKSEPKRGSGHKSN 152
            .       ...||.|:||..:|...|.::         :|...:...|::|||.|      ||: 
  Fly  1275 QRYADKDVSDEPPKKKATMQEDIKLSGIA---------SAPGSDMVACEQCGKME------HKA- 1323

  Fly   153 FLTCKGCMQKWHFPCLPITFHNQSTARKKFKCDKCRYCRLCNVRGPGLSICSLCVDAYHPDCNDP 217
                                          |..:.|||      .||   ||             
  Fly  1324 ------------------------------KLKRKRYC------SPG---CS------------- 1336

  Fly   218 TLKQSKAVEANPNWRCFRCEACNIGGSTSASSEEQTGARKSTASREDQAQPVVPRKSNAGRKKRV 282
              :|:|.               .|||   ..|.|..|.........| |..:|.|...|..::::
  Fly  1337 --RQAKN---------------GIGG---VGSGETNGLGTGGIVGVD-AMALVDRLDEAMAEEKM 1380

  Fly   283 QSEPTGQEKAAKIEKLAKRRQPLKTEKKKEYKKEEDEEPAQIKVKVEKVEPVDMETEQIENNDLP 347
            |:|                          .|:...|..|  |:....:|.|:.|......:...|
  Fly  1381 QTE--------------------------SYQTVSDALP--IQAATPEVPPISMPVLAAMSTSSP 1417

  Fly   348 GPEQESLSLRLT----------------------PITAVERRS------HPVSTWSVEQVVQFVA 384
                  |||.||                      |:.|:...:      .|:|:||||:|..|: 
  Fly  1418 ------LSLPLTLPLPIAIAPTVSLPVVSAGVVAPVLAIPSSNINGSDRPPISSWSVEEVSNFI- 1475

  Fly   385 KRYP---KEANVFRYQDIDGASLLLLNRHDVMNGFGLKLGPALRVFELVMSLQ 434
            :..|   ...:.|..|:|||.:||||..:.::|..|:||||||::...|.|::
  Fly  1476 RELPGCQDYVDDFIQQEIDGQALLLLKENHLVNAMGMKLGPALKIVAKVESIK 1528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584 8/52 (15%)
PHD 189..236 CDD:214584 8/46 (17%)
SAM_Atherin-like 371..438 CDD:188982 27/67 (40%)
SAM 371..436 CDD:197735 27/67 (40%)
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976 28/69 (41%)
SAM 1464..1529 CDD:197735 27/66 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.