DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and tth

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001285216.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster


Alignment Length:107 Identity:24/107 - (22%)
Similarity:43/107 - (40%) Gaps:28/107 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SSAGSNGHDAKSPVVTTAPAATCSVSVSDASGAGASVRTTGRVKKPKQVYDPSDNYVSRASSNRN 85
            |..|||           :.|::.|::::..:|.||:....|.:.             |..:.:.|
  Fly   137 SMPGSN-----------SLASSSSLTLNMLTGGGAAPAVLGSLH-------------SDTAHDFN 177

  Fly    86 SLSSVPATSNVQSPPVKEATDSQDSTTSPVSEQQQQQLQQAA 127
            ...|:..:|::.:    ...|:.||..|...:.||.|.||.|
  Fly   178 GAFSLEESSSLGA----AGGDTSDSKDSQQQQHQQHQHQQQA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584
PHD 189..236 CDD:214584
SAM_Atherin-like 371..438 CDD:188982
SAM 371..436 CDD:197735
tthNP_001285216.1 Requiem_N 24..94 CDD:290758
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3744
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.