DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and Scml4

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_006256634.1 Gene:Scml4 / 309859 RGDID:1310898 Length:414 Species:Rattus norvegicus


Alignment Length:480 Identity:102/480 - (21%)
Similarity:152/480 - (31%) Gaps:165/480 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VQPTTHNSSAGSNG----------------HDAKSPVVTTAPAATCSVSVSDASGAGASVRTTGR 62
            ||...||..:.|:.                :..||||:.| |.|                     
  Rat    21 VQMAVHNLYSASSASVPAVTIPKKRGRKPRYKIKSPVLMT-PLA--------------------- 63

  Fly    63 VKKPKQVYDPSDNYVSRASSNRNSLSSVPA-TSNVQSPPVKEATD-----SQDSTTSPVSEQQQQ 121
            :..|:...:|             .|||:|. .:.|.|..|.:|..     ::.:...|..|:::.
  Rat    64 LSPPRSTPEP-------------DLSSIPQDAATVPSLVVPQAVTVCLYINKQADAGPYLERRKL 115

  Fly   122 Q--------------LQQAAQLRNFDTCQKCGKSEPKR-----GSGHKSNFLTCKGCMQ-KWHFP 166
            |              ||||.|     .|..|. .:|:.     ..|::...::...... |.|..
  Rat   116 QQLPERLGPERPAAVLQQAVQ-----ACIDCA-HQPRLVFSLVKQGYRGELVSVSASFDGKQHLR 174

  Fly   167 CLPITFHNQSTARKKFKCDKCRYCRLC-----NVRGPGLSICSLCVDAYHPDCNDPTLKQSKAVE 226
            .||:.  |......:|....|| ..||     ::..||    |:.......:..|...:.:|...
  Rat   175 NLPVV--NSVGYVLRFLTKLCR-SLLCDNLFSHLPFPG----SIGASEKAQEKEDGRTESAKVAT 232

  Fly   227 ANPNWRCFRCEAC----------NIGGSTSASSEEQTGARKST-----ASREDQAQPVVPRKSNA 276
            |         |.|          .|..|::|.|...:....|:     .:..|......|..:.:
  Rat   233 A---------EECLVNAVGMNRYTIDVSSTAFSHRGSVTHSSSLYYKRLNSGDSHLVGGPATTTS 288

  Fly   277 GRKKRVQSEPTGQEKAAKIEKLAKRRQPLKTEKKKEYKKEEDEEPAQIKVKVEKVEPVDMETEQI 341
            |  .|....|:|......:      |.|..:.|:                          ....|
  Rat   289 G--SRTNPVPSGGSSTPGL------RLPASSPKR--------------------------NGTAI 319

  Fly   342 ENND-LPGPEQESLSLRLTPITAVERRSHPVSTWSVEQVVQFVAKRYPK----EANVFRYQDIDG 401
            |.|. .|.|..|....|       ...|...|||:||.||:||....|:    ...:||..:|||
  Rat   320 EGNRCAPSPSPEIQDTR-------RPSSRNPSTWTVEDVVRFVKDADPQALGPHVELFRKHEIDG 377

  Fly   402 ASLLLLNRHDVMNGFGLKLGPALRV 426
            .:||||....:|...||||||||::
  Rat   378 NALLLLRSDMIMKYLGLKLGPALKL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584 10/58 (17%)
PHD 189..236 CDD:214584 8/51 (16%)
SAM_Atherin-like 371..438 CDD:188982 28/60 (47%)
SAM 371..436 CDD:197735 28/60 (47%)
Scml4XP_006256634.1 RBR 1..60 CDD:407329 9/38 (24%)
SLED 95..203 CDD:403384 22/116 (19%)
SAM_Scm 340..411 CDD:188977 29/63 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.