DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and SCML4

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_016866166.1 Gene:SCML4 / 256380 HGNCID:21397 Length:442 Species:Homo sapiens


Alignment Length:497 Identity:103/497 - (20%)
Similarity:157/497 - (31%) Gaps:195/497 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPVQPTTHN---SSAGS-------------NGHDAKSPVVTTAPAATCSVSVSDASGAGASVRTT 60
            :|::...||   :||||             .|:..||.|:.| |.|                   
Human    47 TPMKMAVHNLYSASAGSLPAVKIPKKRGRKPGYKIKSRVLMT-PLA------------------- 91

  Fly    61 GRVKKPKQVYDPSDNYVSRASSNRNSLSSVPA-TSNVQSPPVKEATD-----SQDSTTSPVSEQQ 119
              :..|:...:|             .|||:|. .:.|.|....:|..     ::.:...|..|::
Human    92 --LSPPRSTPEP-------------DLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERK 141

  Fly   120 QQQ--------------LQQAAQLRNFDTCQKCGKSEP------KRGSGHK--SNFLTCKGCMQK 162
            :.|              ||||.|     .|..|...:.      |:|.|.:  |...:..|   |
Human   142 KVQQLPEHFGPERPSAVLQQAVQ-----ACIDCAHQQKLVFSLVKQGYGGEMVSVSASFDG---K 198

  Fly   163 WHFPCLPITFHNQSTARKKFKCDKCRYCRLCN--------VRGPGLS------------------ 201
            .|...||:.  |......:|....|| ..||:        .||...|                  
Human   199 QHLRSLPVV--NSIGYVLRFLAKLCR-SLLCDDLFSHQPFPRGCSASEKVQEKEEGRMESVKTVT 260

  Fly   202 -----ICSLCVDAYHPDCNDPTLKQSKAVEANPNWRCFRCEA--CNIGGSTSASSEEQTGARKST 259
                 :..:.::.|..|.:..|.....::..:.:..|.|..:  .::||..:|::   .|.|.|.
Human   261 TEEYLVNPVGMNRYSVDTSASTFNHRGSLHPSSSLYCKRQNSGDSHLGGGPAATA---GGPRTSP 322

  Fly   260 ASREDQAQPVVPRKSNAGRKKRVQSEPTGQEKAAKIEKLAKRRQPLKTEKKKEYKKEEDEEPAQI 324
            .|....:.|.:                               |.|..:.|:              
Human   323 MSSGGPSAPGL-------------------------------RPPASSPKR-------------- 342

  Fly   325 KVKVEKVEPVDMETEQIENND-LPGPEQESLSLRLTPITAVERRSHPVSTWSVEQVVQFVAKRYP 388
                        .|..:|.|. ...|.|::...|       ..||...|.|:||.||.||....|
Human   343 ------------NTTSLEGNRCASSPSQDAQDAR-------RPRSRNPSAWTVEDVVWFVKDADP 388

  Fly   389 K----EANVFRYQDIDGASLLLLNRHDVMNGFGLKLGPALRV 426
            :    ...:||..:|||.:||||....||...||||||||::
Human   389 QALGPHVELFRKHEIDGNALLLLKSDMVMKYLGLKLGPALKL 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584 13/60 (22%)
PHD 189..236 CDD:214584 9/77 (12%)
SAM_Atherin-like 371..438 CDD:188982 28/60 (47%)
SAM 371..436 CDD:197735 28/60 (47%)
SCML4XP_016866166.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.