DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and Dpf2

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001278007.1 Gene:Dpf2 / 19708 MGIID:109529 Length:405 Species:Mus musculus


Alignment Length:246 Identity:61/246 - (24%)
Similarity:96/246 - (39%) Gaps:41/246 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEDKEESPVQPTTHNSSAGSNGHDAKSPVVTTAPAATCSVSVSDASGAGA---SVRTTGRVKKPK 67
            |||.||.    |......|.    :||..|::|.....:..:.|.....|   |.:.....|.|:
Mouse   169 DEDYEED----TPKRRGKGK----SKSKGVSSARKKLDASILEDRDKPYACDNSFKQKHTSKAPQ 225

  Fly    68 QVYDPSDNYVSRASSNRNSLSSVPATSNVQSPPVKEATDSQDS-TTSPVSEQQQQQLQQ-----A 126
            :|       ..:...||..||...|.|::..   :|..|.:|| ..:|||::.::|..:     .
Mouse   226 RV-------CGKRYKNRPGLSYHYAHSHLAE---EEGEDKEDSRPPTPVSQRSEEQKSKKGPDGL 280

  Fly   127 AQLRNFDTCQKC-GKSEPKRGSGHKSNFLTCKGCMQKWHFPCL---PITFHNQSTARKKFKCDKC 187
            |...|:  |..| |.|:..:.:|.....::|..|.:..|..||   |:......|.|  ::|.:|
Mouse   281 ALPNNY--CDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYR--WQCIEC 341

  Fly   188 RYCRLCNV--RGPGLSICSLCVDAYHPDCNDPTLKQSKAVEANPNWRCFRC 236
            :.|.||..  ....|..|..|...||..|..|::.:    ....:|.|..|
Mouse   342 KCCNLCGTSENDDQLLFCDDCDRGYHMYCLTPSMSE----PPEGSWSCHLC 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584 14/56 (25%)
PHD 189..236 CDD:214584 12/48 (25%)
SAM_Atherin-like 371..438 CDD:188982
SAM 371..436 CDD:197735
Dpf2NP_001278007.1 Requiem_N 13..79 CDD:290758
PHD1_DPF2_like 286..341 CDD:277161 14/58 (24%)
PHD2_d4 343..388 CDD:277005 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3744
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.