DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2662 and SAMD13

DIOPT Version :9

Sequence 1:	NP_001284832.1	Gene:	CG2662 / 31254	FlyBaseID:	FBgn0024993	Length:	446	Species:	Drosophila melanogaster
Sequence 2:	XP_016855866.1	Gene:	SAMD13 / 148418	HGNCID:	24582	Length:	122	Species:	Homo sapiens

Alignment Length:	131	Identity:	42/131 - (32%)
Similarity:	63/131 - (48%)	Gaps:	38/131 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly   317 EDEEPAQIKVKVEKVEPVDMETEQ---------IENNDLPGPEQESLSLRLTPITAVERRSHPVS 372
            |.:||..:.:.     .||||.::         :||...|.|                      :
Human    12 EVKEPCSLPML-----SVDMENKENGSVGVKNSMENGRPPDP----------------------A 49

  Fly   373 TWSVEQVVQ-FVAKRYPKEANVFRYQDIDGASLLLLNRHDVMNGFGLKLGPALRVFEL-VMSLQT 435
            .|:|..||. |....:.::|:.|:.|:|||.||||:.|:||:.|..|||||||:::|. |..|||
Human    50 DWAVMDVVNYFRTVGFEEQASAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQT 114

  Fly   436 Q 436
            :
Human   115 K 115

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2662	NP_001284832.1	PHD	134..187	CDD:214584
		PHD	189..236	CDD:214584
		SAM_Atherin-like	371..438	CDD:188982	31/68 (46%)
		SAM	371..436	CDD:197735	30/66 (45%)
SAMD13	XP_016855866.1	SAM_Atherin-like	48..116	CDD:188982	32/90 (36%)
SAMD13	XP_016855866.1	SAM	48..104	CDD:197735	27/77 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0004693
OrthoInspector	1	1.000	-	-		otm40259
orthoMCL	1	0.900	-	-		OOG6_107700
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R5854
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	5	4.840