DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and Samd1

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_038954072.1 Gene:Samd1 / 102550189 RGDID:7529921 Length:519 Species:Rattus norvegicus


Alignment Length:269 Identity:63/269 - (23%)
Similarity:99/269 - (36%) Gaps:90/269 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 IGGSTSASSEEQTG---------ARKSTASREDQAQPVVPRKSNAGRKKRVQSEPTGQEKAAKIE 296
            :|||..||.....|         |.:....|.......:||....||     :.|....:||:.:
  Rat   239 LGGSGGASGRLTRGRVQGLLEEEAARGRLERTRLGALALPRGDRPGR-----APPAASARAARSK 298

  Fly   297 KLAKRRQPLKTEKKKEYKKEEDEEPAQIKVK-----VEKVEPVDMETEQIENNDLP--------- 347
            :..:.|   ..||::|..:|:|||..:..|.     .|...|...:..||.....|         
  Rat   299 RGGEER---VFEKEEEDDEEDDEEEEEDNVSEGSEVPESDRPAGAQHHQINGERGPQSAKERVKE 360

  Fly   348 --------------GPEQESLSLRLTPITAV---------------------------------- 364
                          ||...|.:.::..:||:                                  
  Rat   361 WSPCGPFQGQDEGRGPAPGSCTHQVFSMTAMNKEGGSACVTAAPDSPSPVPLPPGKPALPGADGT 425

  Fly   365 ---------ERRSHPVSTWSVEQVVQ-FVAKRYPKEANVFRYQDIDGASLLLLNRHDVMNGFGLK 419
                     |:.:.||. |:|..||: |....:|::|..|:.|:|||.||||:.|.||:.|..::
  Rat   426 PFGCPPGRKEKPTDPVE-WTVMDVVEYFTEAGFPEQATAFQEQEIDGKSLLLMQRTDVLTGLSIR 489

  Fly   420 LGPALRVFE 428
            |||||:::|
  Rat   490 LGPALKIYE 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584
PHD 189..236 CDD:214584
SAM_Atherin-like 371..438 CDD:188982 27/59 (46%)
SAM 371..436 CDD:197735 27/59 (46%)
Samd1XP_038954072.1 SAM_Atherin-like 440..508 CDD:188982 28/60 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004693
OrthoInspector 1 1.000 - - oto95454
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12247
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.100

Return to query results.
Submit another query.