DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and samd13

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_012816011.2 Gene:samd13 / 100135078 XenbaseID:XB-GENE-5864959 Length:116 Species:Xenopus tropicalis


Alignment Length:98 Identity:37/98 - (37%)
Similarity:53/98 - (54%) Gaps:24/98 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 IENNDLPGPEQESLSLRLTPITAVERRSHPVSTWSVEQVVQ-FVAKRYPKEANVFRYQDIDGASL 404
            :||...|.|                  :|    |:|:.||. |....:.::|:.|:.|:|||.||
 Frog    34 VENGRPPDP------------------AH----WAVDDVVNYFKTAGFEEQASAFKEQEIDGKSL 76

  Fly   405 LLLNRHDVMNGFGLKLGPALRVFEL-VMSLQTQ 436
            ||:.|:||:.|..|||||||:::|. |..||||
 Frog    77 LLMTRNDVLTGLSLKLGPALKIYEYHVKPLQTQ 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584
PHD 189..236 CDD:214584
SAM_Atherin-like 371..438 CDD:188982 32/68 (47%)
SAM 371..436 CDD:197735 30/66 (45%)
samd13XP_012816011.2 SAM_Atherin-like 42..110 CDD:188982 34/90 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004693
OrthoInspector 1 1.000 - - oto102194
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5854
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.