DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and scmh1

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001082953.1 Gene:scmh1 / 100037329 ZFINID:ZDB-GENE-070410-82 Length:120 Species:Danio rerio


Alignment Length:93 Identity:21/93 - (22%)
Similarity:38/93 - (40%) Gaps:16/93 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VRTTGRVKKP----KQVYDPSDNYVS-----RASSNRNSLSSVPAT-SNVQSPPVKEATDSQDST 111
            ::.||.|..|    ||..:|.:|...     .|...||:.|:..|| ..:....::...|..|  
Zfish    17 LKETGAVAAPAQYFKQSTEPPENEFKAGMKLEAQDPRNTTSTCIATVVGLTGSRLRLRLDGSD-- 79

  Fly   112 TSPVSEQQQQQLQQAAQLRNFDTCQKCG 139
                ::....:|..:|:::....|:|.|
Zfish    80 ----NKNDFWRLVDSAEIQPIGNCEKNG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584 3/6 (50%)
PHD 189..236 CDD:214584
SAM_Atherin-like 371..438 CDD:188982
SAM 371..436 CDD:197735
scmh1NP_001082953.1 MBT 14..109 CDD:214723 21/93 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.