DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spg7 and AT4G05340

DIOPT Version :10

Sequence 1:NP_570017.1 Gene:Spg7 / 31253 FlyBaseID:FBgn0024992 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_192443.1 Gene:AT4G05340 / 825882 AraportID:AT4G05340 Length:96 Species:Arabidopsis thaliana


Alignment Length:84 Identity:27/84 - (32%)
Similarity:45/84 - (53%) Gaps:15/84 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 ESMGQGSSGESEQ---------TLNQLLVEMDGMATK--EGVLMLASTNRADILDKALLRPGRFD 506
            |:..:|.:||.:.         :|:.||..:||:.:.  |..:::.:||..:.||.|.||||:.|
plant     6 ENKDEGGNGEKQNKKKKNDPQVSLSGLLYFVDGLWSNSVEERIIIFTTNHKEKLDPAFLRPGKMD 70

  Fly   507 RHILIDLPTLAERKEIFEK 525
            .|||:|..|    ..:|:|
plant    71 VHILMDYCT----PVVFKK 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spg7NP_570017.1 HflB 178..788 CDD:440233 27/84 (32%)
AT4G05340NP_192443.1 P-loop containing Nucleoside Triphosphate Hydrolases <6..75 CDD:476819 22/68 (32%)

Return to query results.
Submit another query.